PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00032343-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 211aa    MW: 23893 Da    PI: 9.4645
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00032343-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.2e-1879132957
                         HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   9 keqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         +eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  WALNUT_00032343-RA  79 QEQIGILEMLYKGgMRTPNAQQIEQITAQLgkygKIEGKNVFYWFQNHKARERQ 132
                         79**********99**************************************97 PP

2Wus_type_Homeobox102.92.3e-3377134765
   Wus_type_Homeobox   7 tPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         +P +eQi iLe+lyk G+rtPn+++i++ita+L +yGkie+kNVfyWFQN+kaRerqkq
  WALNUT_00032343-RA  77 SP-QEQIGILEMLYKGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQ 134
                         55.69****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.9E-472137IPR001356Homeobox domain
CDDcd000862.59E-478134No hitNo description
SuperFamilySSF466892.19E-1078138IPR009057Homeodomain-like
PfamPF000461.3E-1579132IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-679132IPR009057Homeodomain-like
PROSITE profilePS500719.70180133IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGSSMKVHQF ARGFWPEHEP SLTLGCKRLR SLAPKLANTV DSTTTTAGVA AFDLKSFIKP  60
ESGPRSKFGS FDEKRDSPQE QIGILEMLYK GGMRTPNAQQ IEQITAQLGK YGKIEGKNVF  120
YWFQNHKARE RQKQKRSSLG LGHCPRTPVP ITTITLETRG GFERDQEVSP YKRKCRSWAS  180
ESLEEEDQSK SCTDQEGDRT LELFPLHPEG R
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018806442.11e-153PREDICTED: WUSCHEL-related homeobox 4-like
RefseqXP_018855673.11e-153PREDICTED: WUSCHEL-related homeobox 4-like
SwissprotQ6X7J96e-64WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A2I4DH221e-151A0A2I4DH22_JUGRE; WUSCHEL-related homeobox 4-like
STRINGEOY144021e-105(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61323452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.12e-66WUSCHEL related homeobox 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  3. Guo X, et al.
    Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation.
    PLoS Pathog., 2017. 13(2): p. e1006142
    [PMID:28158306]
  4. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]
  5. Kucukoglu M,Nilsson J,Zheng B,Chaabouni S,Nilsson O
    WUSCHEL-RELATED HOMEOBOX4 (WOX4)-like genes regulate cambial cell division activity and secondary growth in Populus trees.
    New Phytol., 2017. 215(2): p. 642-657
    [PMID:28609015]
  6. Yamaguchi YL, et al.
    Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots.
    Front Plant Sci, 2017. 8: p. 1195
    [PMID:28747918]