PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00032186-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family BBR-BPC
Protein Properties Length: 280aa    MW: 31369.9 Da    PI: 10.2741
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00032186-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind348.21.8e-10612801301
           GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsek.kaavaerd.........maflqrdkalaernkalver 77 
                         mddd+ + rn+gyyep+  +k +lglqlmss+a+rd+k     r+ n  + ++ ++++++rd          ++  rd++ ++        
  WALNUT_00032186-RA   1 MDDDALNMRNWGYYEPS--FKGHLGLQLMSSMADRDTKHflpgRDPNSIMVNPvNGTFHPRDcvvseapvpLNY-VRDSWANQ-------- 80 
                         9***9999*******99..************************999987766537899****888888887777.78888877........ PP

           GAGA_bind  78 dnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkk 168
                         ++k+l++l+++ +        + vl++t+ ++slq      l+++a +    e   + +ie ++++++e+ ++kkrq++  pk++kakk++
  WALNUT_00032186-RA  81 RDKFLNMLPANPN--------YAVLPETSGAHSLQI-----LQPPALPRD--E--RVSKIE-EPPVKNERGQMKKRQSGDAPKTPKAKKPR 153
                         889******6654........899**********99.....888888822..2..233443.4677888999999999*********9999 PP

           GAGA_bind 169 kksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrK 259
                         k    ++++++++   +r+k  kk+id+v+ng+++D+s++P+PvCsCtG+++qCY+WG+GGWqSaCCtt++S+yPLP+stkrrgaRiagrK
  WALNUT_00032186-RA 154 K----PRDNNNSSV--QRVKPAKKNIDVVINGIDMDISGIPIPVCSCTGTPQQCYRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRK 238
                         9....333444444..689************************************************************************ PP

           GAGA_bind 260 mSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         mSqgafkk+LekLaaeGy+++np+DL++hWA+HGtnkfvtir
  WALNUT_00032186-RA 239 MSQGAFKKVLEKLAAEGYNFANPIDLRTHWARHGTNKFVTIR 280
                         *****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062179.3E-1161280IPR010409GAGA-binding transcriptional activator
SMARTSM012261.1E-1771280IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDDDALNMRN WGYYEPSFKG HLGLQLMSSM ADRDTKHFLP GRDPNSIMVN PVNGTFHPRD  60
CVVSEAPVPL NYVRDSWANQ RDKFLNMLPA NPNYAVLPET SGAHSLQILQ PPALPRDERV  120
SKIEEPPVKN ERGQMKKRQS GDAPKTPKAK KPRKPRDNNN SSVQRVKPAK KNIDVVINGI  180
DMDISGIPIP VCSCTGTPQQ CYRWGCGGWQ SACCTTNVSM YPLPMSTKRR GARIAGRKMS  240
QGAFKKVLEK LAAEGYNFAN PIDLRTHWAR HGTNKFVTIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015867585.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
SwissprotQ9SKD01e-113BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLW9SG761e-178W9SG76_9R
STRINGVIT_01s0011g06380.t011e-155(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-111basic pentacysteine 2