PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00032161-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family bZIP
Protein Properties Length: 206aa    MW: 23723.6 Da    PI: 8.7715
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00032161-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.51.2e-12109167563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         +r +r+++NR +ArrsR+RKk++ie L+  v++ + +N++L ++l +l +  ++  +e+
  WALNUT_00032161-RA 109 RRLKRMISNRDSARRSRLRKKKQIEGLQYQVQQVQIKNQQLSQKLIQLFECNQQILQEN 167
                         689*********************************************99999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-10105169IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.243107170IPR004827Basic-leucine zipper domain
PfamPF001704.4E-11109167IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.53E-10109160No hitNo description
Gene3DG3DSA:1.20.5.1709.1E-10109169No hitNo description
CDDcd147023.77E-13110156No hitNo description
PROSITE patternPS000360112127IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MESNESKGFH DLPHANVLLH FQSLSHTHKH NHILSLLNMQ PDEAEHHSLS HASLSRNPES  60
IPFFFTRFFP DSQTHAPLQK LSPNASSDLS NDTTSDKAKD LQQSIINERR LKRMISNRDS  120
ARRSRLRKKK QIEGLQYQVQ QVQIKNQQLS QKLIQLFECN QQILQENAQL REKVSSLQLV  180
LTDVLTPLGR NVEEDTCNAN RSTTEI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121127RRSRLRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018856866.11e-149PREDICTED: basic leucine zipper 43-like
TrEMBLA0A2I4HL301e-147A0A2I4HL30_JUGRE; basic leucine zipper 43-like
STRINGcassava4.1_026149m2e-58(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.17e-20basic leucine-zipper 70