PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00030812-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 373aa    MW: 42748.6 Da    PI: 6.5127
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00030812-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.11.8e-16951143
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                        ++i+n+  r +t+ kR++g+ KK +E+S+LC++++++ii++++
  WALNUT_00030812-RA  9 EFISNDKSRMITYHKRKKGLEKKLYEISTLCGIKACMIIYGPR 51
                        68***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554558.63E-17154IPR002100Transcription factor, MADS-box
SMARTSM004324.0E-16163IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.554153IPR002100Transcription factor, MADS-box
CDDcd002669.75E-19250No hitNo description
PRINTSPR004049.0E-8323IPR002100Transcription factor, MADS-box
PfamPF003192.4E-161056IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGRRRRSMEF ISNDKSRMIT YHKRKKGLEK KLYEISTLCG IKACMIIYGP RSQNGHPCDM  60
ATWPENDEDC VRTLVNKFKS NTISSARKRG TRDLSDYFID RKKNIEKEIS RKRTENCRSN  120
IMFRTWDERM DYFSYEQLRV VQGFLDTKIE AVQRKIDMLK AADNKSYAMN IDAALEITGN  180
SNDVFGSIPS DFPNYTQGML QRINVGLDLQ ASNNYQLPLP KSCVKSLDDL NGLQWPDFYS  240
SYDQGDHSSL LPFCVNPLAD PMKVKVDEAC SSHGNMSIST GIQYSPPNYP IYYDLNVGLM  300
ENMTVMNNSM LPPMFNYNPR MQLIPPINVR NPMMQTLPDD DQMHGPPADM NSLYTYIGAH  360
GINEFEIDED AAA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1325RRRSMEFISNDKSRMITYHKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018806975.10.0PREDICTED: MADS-box transcription factor PHERES 1-like
TrEMBLA0A2I4DIJ80.0A0A2I4DIJ8_JUGRE; MADS-box transcription factor PHERES 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.11e-20AGAMOUS-like 82