PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00030360-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 309aa    MW: 35222.1 Da    PI: 9.8364
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00030360-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.61.4e-3356109255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH++Fv+av++LGG+++AtPk +l+lm+vkgLt++hvkSHLQ+YR+
  WALNUT_00030360-RA  56 PRLRWTPDLHHCFVHAVQRLGGEDRATPKMVLQLMNVKGLTISHVKSHLQMYRS 109
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.74552112IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-3252111IPR009057Homeodomain-like
SuperFamilySSF466899.32E-1654110IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-2556110IPR006447Myb domain, plants
PfamPF002491.1E-857108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MNISSLKRSP SSSLDNEDCP SQPSHMRVSR PRMDDKLPER GLKSTAVRPY VRSKMPRLRW  60
TPDLHHCFVH AVQRLGGEDR ATPKMVLQLM NVKGLTISHV KSHLQMYRSM KHEQMIQEAA  120
MAAKKNDKAQ GILHSNYNFL CFKQRYFQQS EKFAAVLMMD NNSFQGRNST GTDHCNEDLT  180
PNNTSMPARW VGKQEIMRVG RKMTEPSPIS QEITSKAWEQ KPNSYIIFKD LLESCATRGT  240
NEQRRVPLQD TAAGCQSNDR TKETPAENIE RVDDYKMSLS MNSIGSRSLL KLHKSADHVN  300
DVSLELTLA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY4799624e-39AY479962.1 Juglans nigra microsatellite wga321 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011008685.15e-91PREDICTED: uncharacterized protein LOC105114001
TrEMBLB9RXJ27e-86B9RXJ2_RICCO; DNA binding protein, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.16e-33G2-like family protein