PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00030320-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 79aa    MW: 9415.89 Da    PI: 11.391
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00030320-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-19766357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        +R+++t++ql +Lee++++  r+p+a+++++++++l    +++ ++V++WFqN++ ++++
  WALNUT_00030320-RA  7 SRWCPTSKQLMILEEMYRSgIRTPNASQIQKITANLsfygKIEGKNVFYWFQNHKPRDRQ 66
                        8*****************99***********************************99996 PP

2Wus_type_Homeobox118.23.7e-38567264
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        a++RW+Pt++Q++iLee+y+sG+rtPn+++iq+ita+L+ yGkie+kNVfyWFQN+k R+rqk
  WALNUT_00030320-RA  5 ASSRWCPTSKQLMILEEMYRSGIRTPNASQIQKITANLSFYGKIEGKNVFYWFQNHKPRDRQK 67
                        589***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0036471IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-7766IPR009057Homeodomain-like
SuperFamilySSF466891.07E-10767IPR009057Homeodomain-like
PfamPF000463.7E-17766IPR001356Homeobox domain
PROSITE profilePS500719.5071267IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MSPVASSRWC PTSKQLMILE EMYRSGIRTP NASQIQKITA NLSFYGKIEG KNVFYWFQNH  60
KPRDRQKLRR KVSRQQQLQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:15169755}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018824572.12e-45PREDICTED: WUSCHEL-related homeobox 3-like
SwissprotQ9SIB41e-41WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLA0A2I4EYU94e-44A0A2I4EYU9_JUGRE; WUSCHEL-related homeobox 3-like
STRINGVIT_06s0004g03780.t012e-42(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106322940
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.15e-44WOX family protein
Publications ? help Back to Top
  1. Chandler JW,Werr W
    Arabidopsis floral phytomer development: auxin response relative to biphasic modes of organ initiation.
    J. Exp. Bot., 2014. 65(12): p. 3097-110
    [PMID:24744428]
  2. Niu L, et al.
    LOOSE FLOWER, a WUSCHEL-like Homeobox gene, is required for lateral fusion of floral organs in Medicago truncatula.
    Plant J., 2015. 81(3): p. 480-92
    [PMID:25492397]
  3. Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL
    Active suppression of a leaf meristem orchestrates determinate leaf growth.
    Elife, 2017.
    [PMID:27710768]
  4. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]