PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00029066-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 349aa    MW: 38926.4 Da    PI: 5.8403
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00029066-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.77.5e-2299154156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  WALNUT_00029066-RA  99 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIK 154
                         7999************************************************9877 PP

2START33.87.6e-12269345267
                         HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCC CS
               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveelld 67 
                         + +ea++el+++a+a+ep+W +s+    e++n+de++++++ +++       +s+ea+r++gvv+ +l++l++ + d
  WALNUT_00029066-RA 269 IVNEAMEELITMATAGEPLWIRSVetgrEILNYDEYVKELSAKNSsnnvrpkRSIEASRETGVVFVDLPRLLQCFTD 345
                         6789************************************998889***********************99987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-2484150IPR009057Homeodomain-like
SuperFamilySSF466892.72E-2187157IPR009057Homeodomain-like
PROSITE profilePS5007118.2296156IPR001356Homeobox domain
SMARTSM003898.3E-1998160IPR001356Homeobox domain
PfamPF000463.5E-1999154IPR001356Homeobox domain
CDDcd000863.15E-16103154No hitNo description
PRINTSPR000315.4E-5127136IPR000047Helix-turn-helix motif
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PRINTSPR000315.4E-5136152IPR000047Helix-turn-helix motif
PROSITE profilePS5084810.735259349IPR002913START domain
PfamPF018522.9E-5269346IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGVDMSNNPP TSRTKDFFVS PALSLSLAGI FRDAGAAAAN MEVEEGDEGS GGGGGQREDT  60
AEISSENSGL LRSRSEDDFE GEGEHDDDGD GDKNKKKKRK KYHRHTAEQI REMEALFKES  120
PHPDEKQRQQ LSKQLGLAPR QVKFWFQNRR TQIKAIQERH ENSLLKSEME KLREENKAMR  180
EQINKACCPN CGTATTSQDA AVTTDEQQLK IENARLKTEV EKLRATLGKY PPGTASSSSC  240
STGKDQDSRS SLNFLSGIFG LKKSRVMEIV NEAMEELITM ATAGEPLWIR SVETGREILN  300
YDEYVKELSA KNSSNNVRPK RSIEASRETG VVFVDLPRLL QCFTDVVRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19499KKKKRK
294100KKKKRKK
396100KKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for correct morphological development and maturation of trichomes as well as for normal development of seed coat mucilage. Regulates the frequency of trichome initiation and determines trichome spacing. {ECO:0000269|PubMed:11844112}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by GEM. {ECO:0000269|PubMed:17450124}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018856994.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2-like
SwissprotP466071e-116HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A2I4HLE90.0A0A2I4HLE9_JUGRE; homeobox-leucine zipper protein GLABRA 2-like
STRINGXP_009338062.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47143352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.11e-112HD-ZIP family protein
Publications ? help Back to Top
  1. Wu R,Citovsky V
    Adaptor proteins GIR1 and GIR2. I. Interaction with the repressor GLABRA2 and regulation of root hair development.
    Biochem. Biophys. Res. Commun., 2017. 488(3): p. 547-553
    [PMID:28526410]