PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00028862-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 853aa    MW: 93471.3 Da    PI: 6.4375
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00028862-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.3e-21139194156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  WALNUT_00028862-RA 139 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 194
                         688999***********************************************999 PP

2START203.11.2e-633455691206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela++a++elvk+a+ +ep+Wv+s     e++n +e++++f+   +     + +ea r++g+v+ ++  lve+l+d++ +W e+++    +
  WALNUT_00028862-RA 345 ELALAAMDELVKMAQTDEPLWVRSLeggrEMLNHEEYVRTFTHCIGlkpngFVTEATRETGMVIINSLALVETLIDSN-RWAEMFPyliaR 434
                         5899*************************************88777999999**************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                          +t++vissg      g lqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+ds ++ +  + +v +++lpSg+++++++ng+s
  WALNUT_00028862-RA 435 SSTTDVISSGmggtrnGSLQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDSIRETSAAPTFVNCRRLPSGCVVQDMPNGYS 525
                         ****************************************************************999************************ PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kvtwveh++++++ +h+++r+l++sg+ +ga++w a lqrqce+
  WALNUT_00028862-RA 526 KVTWVEHAEYDESDVHQVYRPLLSSGMGFGAQRWIANLQRQCEC 569
                         ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.11E-20122196IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-21126196IPR009057Homeodomain-like
PROSITE profilePS5007117.216136196IPR001356Homeobox domain
SMARTSM003891.7E-17137200IPR001356Homeobox domain
CDDcd000862.17E-18138196No hitNo description
PfamPF000462.3E-18139194IPR001356Homeobox domain
PROSITE patternPS000270171194IPR017970Homeobox, conserved site
PROSITE profilePS5084844.647336572IPR002913START domain
SuperFamilySSF559611.73E-34338569No hitNo description
CDDcd088751.17E-122340568No hitNo description
PfamPF018521.6E-55345569IPR002913START domain
SMARTSM002347.5E-45345569IPR002913START domain
SuperFamilySSF559617.14E-20590839No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 853 aa     Download sequence    Send to blast
MSFGGFLENT TGGGGARIVA DIPYSNGNLI HNMPAAALAQ SRLVTPPLTK SMFNSSPGLS  60
LGLVRHRTFS HLDLVAFDYH RFLLSLGSIR ADRARMAENF EVNTGRRSRD EEHESRSGSD  120
NMDGASGDDQ DAADNPPRKK RYHRHTPQQI QELEALFKEC PHPDEKQRLE LSRRLCLETR  180
QVKFWFQNRR TQMKTQLERH ENSLLRQEND KLRAENMSIR DAMRNPICSN CGGPSIMGEI  240
SLEEQHLRIE NSRLKDELDR VCALAGKFLG RPISSLANSI GPPLPSSSLE LGVGSNGYGV  300
LSTVATTLPL GPDFGIGISS ALPVMPPART TAGFDRSIER SMFLELALAA MDELVKMAQT  360
DEPLWVRSLE GGREMLNHEE YVRTFTHCIG LKPNGFVTEA TRETGMVIIN SLALVETLID  420
SNRWAEMFPY LIARSSTTDV ISSGMGGTRN GSLQLMHAEL QVLSPLVPVR EVNFLRFCKQ  480
HAEGVWAVVD VSIDSIRETS AAPTFVNCRR LPSGCVVQDM PNGYSKVTWV EHAEYDESDV  540
HQVYRPLLSS GMGFGAQRWI ANLQRQCECL AILMSSAVPT RDHDAITAGG RRSMLKLAQR  600
MTDNFCAGVC ASTVHKWNKL HADNVDEDVR VMTRKSVDDP GEPPGVVLSA ATSVWLPVSP  660
QRLFDFLRNE RLRSEWDILS NGGPMQEMAH IAKGQDHGNC VSLLRAAVSP SFSLLSSLFR  720
ILSFNVDAMN ANQSSMLILQ ETCIDAAGSL VVYAPVDIPA MHVVMNGGDS AYVALLPSGF  780
AIVPDGPGSR GSGETASNGD GPLRVSGSLL TVAFQILVNS LPTAKLTVES VETVNNLISC  840
TVQKIKAALQ CES
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083470.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A067JXS10.0A0A067JXS1_JATCU; Uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein