PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00028669-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 275aa    MW: 31410.8 Da    PI: 5.8826
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00028669-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.61.6e-21116176257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r+R+t+t+ ql++Le+ Fe+ + +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  WALNUT_00028669-RA 116 RQRWTPTPVQLQILERIFEQgTGTPSKHKIKEITSELgqhgQISETNVYNWFQNRRARSKR 176
                         89*****************99**************************************97 PP

2Wus_type_Homeobox101.37.1e-33115178265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         +r+RWtPtp Q++iLe+++++G+ tP+k++i++it+eL ++G+i+++NV++WFQNr+aR+++kq
  WALNUT_00028669-RA 115 SRQRWTPTPVQLQILERIFEQGTGTPSKHKIKEITSELGQHGQISETNVYNWFQNRRARSKRKQ 178
                         789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-18111181IPR009057Homeodomain-like
PROSITE profilePS5007114.852112177IPR001356Homeobox domain
SuperFamilySSF466892.78E-19114180IPR009057Homeodomain-like
SMARTSM003895.4E-16114181IPR001356Homeobox domain
PfamPF000462.7E-19116176IPR001356Homeobox domain
CDDcd000863.32E-14116178No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MTEFSLMDWE KQGNNDHHHH HHHQQDQREE QVQNGSVGNI EVNENGNNGG MLYVKVMTDD  60
QLEILRKQIA VYATICEQLV EMHKNLTAQQ DLAGVRLGNL YCDPLMTSAV HKITSRQRWT  120
PTPVQLQILE RIFEQGTGTP SKHKIKEITS ELGQHGQISE TNVYNWFQNR RARSKRKQQN  180
AAPNTADSEV ETEVDSPKDK KTKPEDFHSQ QNSGPRAEDL CFQNPEISSD LHFLDPQSSK  240
EETMFPSDGS IKIARGLDQI SFYDGLQSNP SMYVL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169177RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018857699.10.0PREDICTED: WUSCHEL-related homeobox 13
SwissprotO817882e-86WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A2I4HNG10.0A0A2I4HNG1_JUGRE; WUSCHEL-related homeobox 13
STRINGXP_008241933.11e-131(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.15e-87WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]