PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00028267-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 291aa    MW: 33064 Da    PI: 6.9016
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00028267-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.83.8e-1882134456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         + +++ eq+++Le+ Fe  +++  e++++LAk lgL+ rq+ +WFqNrRa++k
  WALNUT_00028267-RA  82 KKRLNLEQVKALEKSFELGNKLEPERKTQLAKALGLQPRQIAIWFQNRRARWK 134
                         4568889*********************************************9 PP

2HD-ZIP_I/II128.62.6e-4180172193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekk+rl+ eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdye+Lk++++alk++n++L++++++L++el
  WALNUT_00028267-RA  80 EKKKRLNLEQVKALEKSFELGNKLEPERKTQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYEVLKKQFEALKADNDALHAQNKKLNAEL 170
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  WALNUT_00028267-RA 171 SA 172
                         75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-1970138IPR009057Homeodomain-like
PROSITE profilePS5007116.90876136IPR001356Homeobox domain
SMARTSM003899.9E-1879140IPR001356Homeobox domain
CDDcd000862.33E-1681137No hitNo description
PfamPF000462.3E-1582134IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-1984143IPR009057Homeodomain-like
PRINTSPR000318.7E-6107116IPR000047Helix-turn-helix motif
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PRINTSPR000318.7E-6116132IPR000047Helix-turn-helix motif
PfamPF021831.5E-14136175IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MIFSNDMAFP SSHSFMFQTH EDQDHLPSSN TLPSCPPQQY YHGGVPFLMN RSMSFSGIDN  60
KCGEVHGDDE LSDDGTQIGE KKKRLNLEQV KALEKSFELG NKLEPERKTQ LAKALGLQPR  120
QIAIWFQNRR ARWKTKQLEK DYEVLKKQFE ALKADNDALH AQNKKLNAEL SALKSSDTNE  180
VGLKNMKKET ECSWSNGSEN SCDINLDISR TPAVMNGPVS SRLSSKHIFP SCIRPTASMS  240
QLLQGSSRSS DLQCLKTDQM TQDAGFSNMF NGIEDQHNFW PWPEQHQQHF H
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128136RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032488.11e-143Homeobox protein 20
SwissprotQ004662e-86HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A061EM691e-143A0A061EM69_THECC; Homeobox protein 20
STRINGPOPTR_0017s11800.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-87homeobox 3