PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00028098-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 729aa    MW: 80096 Da    PI: 6.0837
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00028098-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.62.8e-2061116156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  WALNUT_00028098-RA  61 RKRYHRHTQSQIQEMEAFFKECPHPDDKQRKELSRHLGLEPLQVKFWFQNKRTQMK 116
                         789999***********************************************998 PP

2START213.76.5e-672514701206
                         HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
               START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                         ela +a++el+++a+ +ep+Wv+     e++n++e+l++f+++ +      ++ea+r+s+vv+m++++lve+l+d+k +W+  +     +a
  WALNUT_00028098-RA 251 ELAVAAMEELIRMAQGGEPLWVSCDnsaEILNEEEYLRTFPRGIGpkplgLKSEASRESVVVIMNHMNLVEILMDVK-RWSSVFCgivsRA 340
                         57899******************99999**************999********************************.*****999999** PP

                         EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
               START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                         +tl+v+s+g      galq+m+ae+q++spl p R+ +fvRy++q+ +g+w++vdvS+d+ ++      + R++++pSg+li++++ng+sk
  WALNUT_00028098-RA 341 MTLDVLSTGvagnynGALQVMTAEFQVPSPLFPtRENYFVRYCKQHVDGTWAVVDVSLDNLRPGM----ISRSRRRPSGCLIQELPNGYSK 427
                         ***************************************************************98....69******************** PP

                         EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         v+wvehv++++r +++++r+l++sgla+gak+wvatl+rqce+
  WALNUT_00028098-RA 428 VVWVEHVEVDDRAVQSMYRPLLNSGLAFGAKRWVATLDRQCER 470
                         *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-2248116IPR009057Homeodomain-like
SuperFamilySSF466893.55E-1948118IPR009057Homeodomain-like
PROSITE profilePS5007116.8658118IPR001356Homeobox domain
SMARTSM003899.0E-1959122IPR001356Homeobox domain
CDDcd000863.10E-1860119No hitNo description
PfamPF000465.8E-1861116IPR001356Homeobox domain
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
PROSITE profilePS5084843.593242473IPR002913START domain
SuperFamilySSF559611.51E-33242472No hitNo description
CDDcd088759.29E-123246469No hitNo description
SMARTSM002341.5E-71251470IPR002913START domain
PfamPF018522.3E-55252470IPR002913START domain
Gene3DG3DSA:3.30.530.201.1E-4346469IPR023393START-like domain
SuperFamilySSF559612.64E-24491720No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048825Biological Processcotyledon development
GO:0090627Biological Processplant epidermal cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 729 aa     Download sequence    Send to blast
MFQPNIFDAD HHHMLDMAPN SPENEFGKII REDDFEARSG AETTLEAPSG EDQDPNQRSK  60
RKRYHRHTQS QIQEMEAFFK ECPHPDDKQR KELSRHLGLE PLQVKFWFQN KRTQMKAQHE  120
RHENAILKAE NEKLRAENTR FKEALGNASC PNCGGPAALG EMSFDEQHLR IENVRLREEI  180
DRLSGIAAKY VGKPLSSYSQ LSTHVPSRSL DLGAGNFGAQ SGFVGEMYGG SNDLLRSISG  240
PTEADKPLIV ELAVAAMEEL IRMAQGGEPL WVSCDNSAEI LNEEEYLRTF PRGIGPKPLG  300
LKSEASRESV VVIMNHMNLV EILMDVKRWS SVFCGIVSRA MTLDVLSTGV AGNYNGALQV  360
MTAEFQVPSP LFPTRENYFV RYCKQHVDGT WAVVDVSLDN LRPGMISRSR RRPSGCLIQE  420
LPNGYSKVVW VEHVEVDDRA VQSMYRPLLN SGLAFGAKRW VATLDRQCER LASSMASNIP  480
AGDLCVITST EGRKSMLKLA ERMVMSFCTG VGASTAHAWT TLSATGSDDV RVMTRKSMDD  540
PGRPPGIVLS AATSFWIPVP AKRIFDFLRD ENSRREWDIL SNGGLVQEMA HIANGRDPGN  600
CVSLLRVNSA NSSQSNMLIL QESCTDSIGS YVIYAPVDIV AMNVVLSGGD PDYVALLPSG  660
FAILPDGPGL NGGGIHEVGS CGSLLTVAFQ ILVDSVPSAK LSLGSVATVN SLIKCTVEKI  720
KSALMCESS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in cell specification and pattern formation during embryogenesis. Binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to PDF2. {ECO:0000269|PubMed:11439135, ECO:0000269|PubMed:12505995}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018820351.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
RefseqXP_018820352.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLA0A2I4ELS70.0A0A2I4ELS7_JUGRE; homeobox-leucine zipper protein MERISTEM L1-like
STRINGEOY286240.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Takada S,Takada N,Yoshida A
    Induction of epidermal cell fate in Arabidopsis shoots.
    Plant Signal Behav, 2013. 8(11): p. e26236
    [PMID:23989220]
  3. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  4. Katagiri Y, et al.
    The coordination of ploidy and cell size differs between cell layers in leaves.
    Development, 2016. 143(7): p. 1120-5
    [PMID:26903507]
  5. Seeliger I, et al.
    The AP2-type transcription factors DORNRĂ–SCHEN and DORNRĂ–SCHEN-LIKE promote G1/S transition.
    Mol. Genet. Genomics, 2016. 291(5): p. 1835-49
    [PMID:27277595]
  6. Schwarz EM,Roeder AH
    Transcriptomic Effects of the Cell Cycle Regulator LGO in Arabidopsis Sepals.
    Front Plant Sci, 2016. 7: p. 1744
    [PMID:27920789]
  7. Meyer HM, et al.
    Fluctuations of the transcription factor ATML1 generate the pattern of giant cells in the Arabidopsis sepal.
    Elife, 2018.
    [PMID:28145865]