PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00027490-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 358aa    MW: 40118 Da    PI: 6.0683
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00027490-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.18.1e-28196246151
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                         k+r+ W+p+LH++F+eav+qLGG+++AtPk+i+elm+v+gLt+++vkSHLQ
  WALNUT_00027490-RA 196 KQRRYWSPQLHRCFLEAVQQLGGEQVATPKQIRELMQVDGLTNDEVKSHLQ 246
                         79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.376193253IPR017930Myb domain
SuperFamilySSF466891.74E-13194246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-23195246IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23196247IPR006447Myb domain, plants
PfamPF002491.1E-6199246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MELTLDLSRV FVPKTISELV REISTAGNSS EKLSKLHDCV QRLEDERSKI EGFKRELPLC  60
MNLLNDAIGR LKEAAMHCME SDNDDKKNWM NSAQLWITGP DYDYKKEESA SEAKLHGEED  120
DWSVLENPIQ PQSNRNMGGN FPSLKEENEV SQVTSLSLMT PLPELNPSDS VSKRRTSFGC  180
RGSNSGSSLL TEPPRKQRRY WSPQLHRCFL EAVQQLGGEQ VATPKQIREL MQVDGLTNDE  240
VKSHLQVGIH GLFSQVLSYV IPSSLLFKVI YLDIMPWQKY RLHVQRRASS SSANGLWMAQ  300
DQHRKRSNPN TSQSGSPKGT LLAGVSAKDL FSIGDNSKEA EADEESDGHS CKGGLQEP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890038.11e-98PREDICTED: uncharacterized protein LOC107424698
TrEMBLM5WFN32e-98M5WFN3_PRUPE; Uncharacterized protein
STRINGPOPTR_0007s11470.11e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-54G2-like family protein