PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00027263-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 314aa    MW: 33993 Da    PI: 6.882
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00027263-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.61.8e-30107160155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  WALNUT_00027263-RA 107 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 160
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-20104164IPR009057Homeodomain-like
PROSITE profilePS5129411.059104163IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-30106165IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-24108160IPR006447Myb domain, plants
PfamPF002491.2E-7110159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MREEDSNWFS RWEEELPSPE ELMPLSQTLI TPDLALAFDI RSPNNINNNS PTQPQAPPQS  60
QPQPSPSNPL PASATTPPHP NSAEFASDSA DLGSGPGGEE PARTLKRPRL VWTPQLHKRF  120
VDAVAHLGIK NAVPKTIMQL MSVDGLTREN VASHLQKYRL YLKRMQGLSA GSGGAGGAGG  180
LPATADPATD HLFASSPVPP HFLHPGRPNS DFLPFVPVAA LQHHHHQQQQ QQMAAVAAAA  240
AHPQLQQQYH RQVGHFGSPP SGQFEHPFLS RQSQPLHRMG TPVHNLVPGY VEDLESANGT  300
GGRKVLTLFP TGDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-20106165463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036386.11e-143PREDICTED: transcription factor PCL1-like
TrEMBLA0A059A3P31e-143A0A059A3P3_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s03340.11e-133(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.19e-85G2-like family protein