PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00027093-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 391aa    MW: 43716 Da    PI: 6.6344
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00027093-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1048.8e-33246301156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  WALNUT_00027093-RA 246 KQRRCWSPELHRRFVNALQQLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 301
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.115243303IPR017930Myb domain
SuperFamilySSF466892.99E-18243304IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-30244304IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-27246301IPR006447Myb domain, plants
PfamPF002496.0E-8248299IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MGSVHPELSF DFRPTFVPKT ISDFLGEVSM IGNVLERASK LEDFVKRLEE EMWKIDAFKR  60
ELPLCMTLLN DAIRALKEES IQRITPKEVQ PVLEEFIPLK KECDRNMENK TEKDCRDKKN  120
WMSSVQLWNT DDCPSTDCAK PNPKSETKRS DEESNLGTED PFQSDRSRDE AVGFLPFKKY  180
SGFPVVNKEG KEEFPVHGLS LLTPVIKNPR EESGSNGSRN ACSKAVSSSD PTTNIRTLTQ  240
QQTARKQRRC WSPELHRRFV NALQQLGGSQ AATPKQIREL MQVDGLTNDE VKSHLQKYRL  300
HTRRVPAAAS AAPEKQSVVV LGGVWMAQEQ YGESSKAHSS ESGSPQGPLQ LTGNTGGTST  360
TGGDSMEDDE DAKSEGYSWK SHNPKPGKVN V
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284970.21e-177PREDICTED: uncharacterized protein LOC100267475 isoform X2
TrEMBLD7TPP21e-177D7TPP2_VITVI; Putative uncharacterized protein
TrEMBLA5BS051e-177A5BS05_VITVI; Putative uncharacterized protein
STRINGVIT_03s0063g01060.t011e-176(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.14e-61G2-like family protein