PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00026436-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 344aa    MW: 38333.1 Da    PI: 8.2799
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00026436-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45.2e-18179233256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ ++tkeq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  WALNUT_00026436-RA 179 RKKLRLTKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 233
                         788899***********************************************98 PP

2HD-ZIP_I/II126.51.2e-40179269192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rl+keq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en++L+ke +eLr +l
  WALNUT_00026436-RA 179 RKKLRLTKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTQENRKLQKELQELR-AL 268
                         69*************************************************************************************9.55 PP

         HD-ZIP_I/II  92 k 92 
                         k
  WALNUT_00026436-RA 269 K 269
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.1E-7112146IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.4E-17166236IPR009057Homeodomain-like
PROSITE profilePS5007117.313175235IPR001356Homeobox domain
SuperFamilySSF466893.76E-18176244IPR009057Homeodomain-like
SMARTSM003895.1E-16177239IPR001356Homeobox domain
CDDcd000862.20E-15179236No hitNo description
PfamPF000461.5E-15179233IPR001356Homeobox domain
PROSITE patternPS000270210233IPR017970Homeobox, conserved site
PfamPF021839.2E-11235269IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.2E-24235278IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MELALSLGDT PKPFTFLDKT PKMSSKDVGF CMGLGSAFSG RSDEKREIRE GEDRREVIRD  60
EGERRLLSSD PPVQLDLLPF SPVPRSQPPT QLRFPWLADN LVPEPGPSDG TGKGLDVNRF  120
PAVAIAAEEA DDGTALSSPN STVSSFQMDF CVRNGGRTKR DLELETERAS DDDENGSTRK  180
KLRLTKEQSA FLEESFKEHS TLNPKQKLAL AKQLNLRPRQ VEVWFQNRRA RTKLKQTEVD  240
CEYLKRCCET LTQENRKLQK ELQELRALKT SQPFYMQLPA TTLTMCPSCE RVATTTTTTG  300
SSGATAGNNN NSTTNKAALS LAKGRLYQVQ QAHMHQAQPH QAAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177183TRKKLRL
2227235RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018813245.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotP466651e-100HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2I4E1H60.0A0A2I4E1H6_JUGRE; homeobox-leucine zipper protein HOX11-like
STRINGEOY095241e-163(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-86homeobox from Arabidopsis thaliana