PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00026034-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 760aa    MW: 82996 Da    PI: 5.8486
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00026034-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2090145156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  WALNUT_00026034-RA  90 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 145
                         688999***********************************************999 PP

2START219.98.5e-692804991206
                         HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
               START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                         ela +a++elv++a+ +ep+W++     + + +de++++f+++ +     ++ ea+r+++vv+m++ +lve+l+d++ qW++ +     +a
  WALNUT_00026034-RA 280 ELAVAAMEELVRMAQMGEPLWMTNLdgtSTLHEDEYIRTFPRGIGprpisFKCEASRETAVVIMNHINLVEILMDVN-QWSTVFSgivsRA 369
                         57899**********************99*************999********************************.************* PP

                         EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
               START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                          tlev+s+g      galq+m+ae+q++splvp R++++vRy++q+ +g+w++vdvS+d  ++ p     vR++++pSg+li++++ng+sk
  WALNUT_00026034-RA 370 LTLEVLSTGvagnynGALQVMTAEFQVPSPLVPtRESYYVRYCKQHADGTWAVVDVSLDDLRPSPA----VRSRRRPSGCLIQEMPNGYSK 456
                         ***************************************************************995....********************* PP

                         EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         vtwvehv++++r +h+l+++lv+sg+a+gak+wvatl+rqce+
  WALNUT_00026034-RA 457 VTWVEHVEVDDRGVHNLYKQLVSSGHAFGAKRWVATLDRQCER 499
                         *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-2270145IPR009057Homeodomain-like
SuperFamilySSF466891.0E-1976147IPR009057Homeodomain-like
PROSITE profilePS5007116.95787147IPR001356Homeobox domain
SMARTSM003894.8E-2088151IPR001356Homeobox domain
CDDcd000862.69E-1990148No hitNo description
PfamPF000464.3E-1890145IPR001356Homeobox domain
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
SuperFamilySSF559612.79E-36271501No hitNo description
PROSITE profilePS5084845.333271502IPR002913START domain
CDDcd088752.55E-128275498No hitNo description
SMARTSM002343.1E-65280499IPR002913START domain
PfamPF018522.0E-58281499IPR002913START domain
Gene3DG3DSA:3.30.530.204.5E-7376481IPR023393START-like domain
SuperFamilySSF559616.87E-24518752No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010090Biological Processtrichome morphogenesis
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MPAGIMVPAR NMPSMIGRNG TVGGYGSSSG LTLSQPNMME GQLHPLDMTQ NTSESEIARI  60
RDDDFDSGTK SGSENHEGAS GDDQDPRPKK KRYHRHTQHQ IQEMEAFFKE CPHPDDKQRK  120
ELSRELGLEP LQVKFWFQNK RTQMKTQHER HENTQLRTEN EKLRADNMRY RDALSNASCP  180
NCGGPTAIGE MSFDEHHLRL ENVRLREEID RISAIAAKYV GKPVVNYPLL SPPVPPRPLD  240
LGVGTFGGQP AGIGGEMYGA GDLLRSISAP TEADKPMIIE LAVAAMEELV RMAQMGEPLW  300
MTNLDGTSTL HEDEYIRTFP RGIGPRPISF KCEASRETAV VIMNHINLVE ILMDVNQWST  360
VFSGIVSRAL TLEVLSTGVA GNYNGALQVM TAEFQVPSPL VPTRESYYVR YCKQHADGTW  420
AVVDVSLDDL RPSPAVRSRR RPSGCLIQEM PNGYSKVTWV EHVEVDDRGV HNLYKQLVSS  480
GHAFGAKRWV ATLDRQCERL ASAMASNIPT GDVGVITNQE GRKSMLKLAE RMVISFCAGV  540
SASTTHTWTT LSGTGADDVR VMTRKSIDDP GRPPGIVLSA ATSFWLPVPP KRVFDFLRDE  600
NSRSEWDILS NGGVVQEMAH IANGRDTGNS VSLLRVNSAN SSQSNMLILQ ESCTDQTASF  660
VIYAPVDIVA MNLVLNGGDP DYVALLPSGF AILPDGTSST LGAGCIGEAE SGGSLLTVAF  720
QILVDSVPTA KLSLGSVATV NNLIACTVER IKASLSCENA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015383008.10.0PREDICTED: homeobox-leucine zipper protein HDG2 isoform X2
RefseqXP_006447539.10.0hypothetical protein CICLE_v10014373mg
RefseqXP_006447538.10.0hypothetical protein CICLE_v10014373mg
RefseqXP_006447537.10.0hypothetical protein CICLE_v10014373mg
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLV4W4610.0V4W461_9R
STRINGPOPTR_0014s15010.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2