PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00025961-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family GRAS
Protein Properties Length: 457aa    MW: 51209.3 Da    PI: 5.7197
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00025961-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS306.84.9e-94524532373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.....sseelaalkl..fs 85 
                         ++lL++cA+a++s+d++laq++L+ l+++a+pdgd++qRl+  f++AL ar a+  ++ +k l++ +++++n     ++ ++    l  f+
  WALNUT_00025961-RA  52 EQLLVHCANAIESNDATLAQQILWVLNNIATPDGDSNQRLTCGFLRALIARAAK--TGSCKMLAAMANAHSNiaidtHKFSIIE--LasFV 138
                         79****************************************************..5555556555555555444223333333..366** PP

                GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelg 173
                         +++P+++f++ +aN aIleaveg + +Hi+D+++++++Q p+L++a+a+R e pp +++T+  s+e +      ++ee+g++L +fA++ +
  WALNUT_00025961-RA 139 DLTPWHRFGFTAANAAILEAVEGYSIIHIVDLSLTHCMQIPTLIDAIANRHEVPPLVKLTVATSMEDVppkLDLSYEELGSKLVNFARSKN 229
                         ****************************************************************998897777899*************** PP

                GRAS 174 vpfefnvl...vakrledleleeLrvkp......gEalaVnlvlqlhrll..................desvsleserdevLklvkslsPk 237
                         v +ef+v    + + +++l +e+Lrv++      gEal++n++++lh+++                  + s +++s r+ +Lk ++sl P+
  WALNUT_00025961-RA 230 VMMEFRVSpssYKDGFATL-IEQLRVQHlvypesGEALVINCQMMLHYIPeetvnvaipsansnpydfECSSTTSSFRTMFLKSLRSLDPT 319
                         ******9777633334444.66666665666669********************************997778888889************* PP

                GRAS 238 vvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvp 328
                         +vv+v+++ad++s++ + r+ +a++y +  +d++++ lp+ s++r+++E+  + ++i+nv+a+eg++r+er et ++W +r+++a F+ ++
  WALNUT_00025961-RA 320 IVVLVDEDADLTSNDVVSRLRSAFNYLWIPYDTMDTFLPTGSKQRQWYEAN-ICWKIENVIANEGFHRVERPETRSQWVQRMRNADFRGIS 409
                         ***************************************************.*************************************** PP

                GRAS 329 lsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                         ++e+a++++k++l +++  g+ +++e++ lvl+Wk++++v+++aW
  WALNUT_00025961-RA 410 FGEDAVSEVKTMLDEHA-AGWGLKKEEDNLVLTWKGHNVVFATAW 453
                         *****************.8999*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.11325435IPR005202Transcription factor GRAS
Gene3DG3DSA:1.25.10.102.8E-446128IPR011989Armadillo-like helical
PfamPF035141.7E-9152453IPR005202Transcription factor GRAS
Gene3DG3DSA:1.25.10.102.8E-4178198IPR011989Armadillo-like helical
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MQFTEAPPQS LHQMTPFSNP TMNKSQFHRT RPWPGFPTSK SLGSFGDANC MEQLLVHCAN  60
AIESNDATLA QQILWVLNNI ATPDGDSNQR LTCGFLRALI ARAAKTGSCK MLAAMANAHS  120
NIAIDTHKFS IIELASFVDL TPWHRFGFTA ANAAILEAVE GYSIIHIVDL SLTHCMQIPT  180
LIDAIANRHE VPPLVKLTVA TSMEDVPPKL DLSYEELGSK LVNFARSKNV MMEFRVSPSS  240
YKDGFATLIE QLRVQHLVYP ESGEALVINC QMMLHYIPEE TVNVAIPSAN SNPYDFECSS  300
TTSSFRTMFL KSLRSLDPTI VVLVDEDADL TSNDVVSRLR SAFNYLWIPY DTMDTFLPTG  360
SKQRQWYEAN ICWKIENVIA NEGFHRVERP ETRSQWVQRM RNADFRGISF GEDAVSEVKT  420
MLDEHAAGWG LKKEEDNLVL TWKGHNVVFA TAWLPAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B6e-474645582474Protein SHORT-ROOT
5b3h_B3e-474745529420Protein SHORT-ROOT
5b3h_E3e-474745529420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018809230.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2I4DQ050.0A0A2I4DQ05_JUGRE; scarecrow-like protein 32
STRINGEOX916400.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein