PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00025046-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family GRAS
Protein Properties Length: 362aa    MW: 40711.7 Da    PI: 7.7929
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00025046-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS33.84.4e-11103156255
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55 
                         ++lL  cA a+++g++++ q+lL  l+elas +gd+++Rla++ ++ALa+++  
  WALNUT_00025046-RA 103 EQLLNPCAAAITEGNMSRLQHLLYVLQELASHTGDSNRRLAFHGLRALAQHIRT 156
                         689***********************************************9986 PP

2GRAS82.95.5e-26166358128320
                GRAS 128 LlqaLasRpegppslRiTgvgspesg.........skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlq 209
                         Ll  La+ +  p  +RiT++++ +++               ++ +rL  fA++++v++++n l  + l++l  ++++++p+ +l+V+ +++
  WALNUT_00025046-RA 166 LLSRLAK-STYPSLVRITVIANTDENdqnketpfsVGPPGDNVSSRLLCFAKSMNVNLQINRLNNHPLQSLGAQAINTSPDGTLIVCAQFR 255
                         6777776.466789*******987778777776666667799********************9999************************* PP

                GRAS 210 lhrlldesvsleserdevLklvkslsPkvvvvveqe..adh.nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                         l +l    +++++er+e+L+++++++Pk v+++e+   +++ n ++F+++f++ ++y + ++ds+++ +    + r + Er+l++ e+ ++
  WALNUT_00025046-RA 256 LRHLN---HNSPDERTEFLRVLRGMEPKGVILSENStdCSCkNCGNFATGFSRRVDYLWRFLDSTSSAF----KGRESEERRLMEGEAAKA 339
                         ****8...66666788******************98335558889********************7775....666666777777778777 PP

                GRAS 298 vacegaerrerhetlekWrerle 320
                         +++    rre +e +ekW er++
  WALNUT_00025046-RA 340 LTN----RREMNEGKEKWCERMR 358
                         766....55569**********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098510.1691362IPR005202Transcription factor GRAS
PfamPF035141.5E-8103156IPR005202Transcription factor GRAS
PfamPF035141.9E-23166358IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MRDINGYQWW DESPEVGQDL FDYSAIAAAT CTVPTNPTVF NHPSPANSSK KRKASDNILS  60
KQSVNYLSPQ KNQSQRITNA DIGFAEVEEL RSPLEDKEGR WAEQLLNPCA AAITEGNMSR  120
LQHLLYVLQE LASHTGDSNR RLAFHGLRAL AQHIRTTHIP HLDLLLLSRL AKSTYPSLVR  180
ITVIANTDEN DQNKETPFSV GPPGDNVSSR LLCFAKSMNV NLQINRLNNH PLQSLGAQAI  240
NTSPDGTLIV CAQFRLRHLN HNSPDERTEF LRVLRGMEPK GVILSENSTD CSCKNCGNFA  300
TGFSRRVDYL WRFLDSTSSA FKGRESEERR LMEGEAAKAL TNRREMNEGK EKWCERMRGV  360
ES
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069237.11e-126PREDICTED: nodulation-signaling pathway 1 protein
SwissprotQ4VYC83e-94NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A067L8A61e-126A0A067L8A6_JATCU; GRAS11 protein
STRINGVIT_09s0002g01190.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.13e-60GRAS family protein