PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00023724-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 283aa    MW: 32705.8 Da    PI: 7.0725
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00023724-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.1e-1884136456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         + +++ eq++ Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  WALNUT_00023724-RA  84 KKRLSLEQVKGLEKSFELGNKLEPERKVQLAKALGLQPRQIAIWFQNRRARWK 136
                         556899**********************************************9 PP

2HD-ZIP_I/II127.65.4e-4182172191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekk+rls eqvk LE+sFe  +kLeperKv+la++Lglqprq+a+WFqnrRAR+ktkqlEkdye+Lk+++++lk++n++L++++++L++el
  WALNUT_00023724-RA  82 EKKKRLSLEQVKGLEKSFELGNKLEPERKVQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYEVLKKQFESLKADNDALQAQNRKLNAEL 172
                         69*************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.11E-1874140IPR009057Homeodomain-like
PROSITE profilePS5007116.42278138IPR001356Homeobox domain
SMARTSM003895.8E-1881142IPR001356Homeobox domain
CDDcd000863.08E-1583139No hitNo description
PfamPF000464.6E-1584136IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-1885145IPR009057Homeodomain-like
PRINTSPR000319.9E-6109118IPR000047Helix-turn-helix motif
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PRINTSPR000319.9E-6118134IPR000047Helix-turn-helix motif
PfamPF021837.6E-14138178IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MIFSNDMMAF APSHSFMFQT QEDDQDHLSS SNTLRACLPQ QYYHGGAPSL MKRSMSFSGI  60
YNKCDEVHGD DELSDDGIQI GEKKKRLSLE QVKGLEKSFE LGNKLEPERK VQLAKALGLQ  120
PRQIAIWFQN RRARWKTKQL EKDYEVLKKQ FESLKADNDA LQAQNRKLNA ELLVLKSKDQ  180
TNEAGVKSMK KETEFSWSNG SESSCDMINL DNSRKLSSKH LFPSSLIRPT SMPQLLQSSS  240
RSDHLQWVKT GHMTQDESLS NMFMTNIEDQ HDFWPWPEQQ HFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130138RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018813793.10.0PREDICTED: homeobox-leucine zipper protein HAT7-like
SwissprotQ004663e-75HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A2I4E3280.0A0A2I4E328_JUGRE; homeobox-leucine zipper protein HAT7-like
STRINGEOY034141e-120(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-77homeobox 3