PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00023696-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 732aa    MW: 80496.6 Da    PI: 6.3583
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00023696-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-1963118156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r++ +++t+ q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  WALNUT_00023696-RA  63 RKRYHRHTQGQIQEMETFFKECPHPDDRQRKELSRQLGLEPLQVKFWFQNKRTQMK 118
                         789999***********************************************998 PP

2START218.81.8e-682534721206
                         HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
               START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                         ela +a++elv++a+ +ep+Wv+ +   e++n++e+l++f+++ +      ++ea+r+s+vv+m++ +lve+l+d+k +W++ +     +a
  WALNUT_00023696-RA 253 ELAVAAMEELVRMAQGGEPLWVSCAnstEILNEEEYLRTFPRGIGpkplgLKSEASRESAVVIMNHINLVEILMDVK-RWSTVFCgivsRA 342
                         57899*************************************999********************************.******99999** PP

                         EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
               START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                         +tl+v+s+g      galq+m+ae+q++splvp R+ +fvRy++q+ +g+w++vdvS+d+ ++      + R++++pSg+li++++ng+sk
  WALNUT_00023696-RA 343 TTLDVLSTGvagnynGALQVMKAEFQVPSPLVPtRENYFVRYCKQHADGTWAVVDVSLDNLRPSF----ISRSRRRPSGCLIQELPNGYSK 429
                         **************************************************************976....79******************** PP

                         EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         v+w+ehv++++r +h+++r+lv+sg+a+gak+w+atl+rqce+
  WALNUT_00023696-RA 430 VIWIEHVEVDDRAVHSIYRPLVNSGIAFGAKRWLATLDRQCER 472
                         *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.85E-1948120IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-2249118IPR009057Homeodomain-like
PROSITE profilePS5007116.79560120IPR001356Homeobox domain
SMARTSM003895.3E-1861124IPR001356Homeobox domain
CDDcd000866.80E-1862121No hitNo description
PfamPF000462.9E-1763118IPR001356Homeobox domain
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
SuperFamilySSF559615.38E-36244473No hitNo description
PROSITE profilePS5084845.505244475IPR002913START domain
CDDcd088757.48E-128248471No hitNo description
SMARTSM002341.2E-72253472IPR002913START domain
PfamPF018525.0E-57254472IPR002913START domain
Gene3DG3DSA:3.30.530.205.1E-6348472IPR023393START-like domain
SuperFamilySSF559611.87E-22493724No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MEMFQPNMFD THHLMLDIMT PKSSESELVK IRDQDDFETG SGTEIMEVAP SGEDQDPNQS  60
SKRKRYHRHT QGQIQEMETF FKECPHPDDR QRKELSRQLG LEPLQVKFWF QNKRTQMKAQ  120
HERHENAILK AENEKLRAEN NRFKESLGNT SCPNCGGPAT LGEMSFDEQH LRIENARLRE  180
EIDRISVIAA KYVGKPLTSY SHLSPLVPSR SGLDLGVGNF KAQTGFVGEM YGGNDLLRSV  240
SGPTEADKPM IVELAVAAME ELVRMAQGGE PLWVSCANST EILNEEEYLR TFPRGIGPKP  300
LGLKSEASRE SAVVIMNHIN LVEILMDVKR WSTVFCGIVS RATTLDVLST GVAGNYNGAL  360
QVMKAEFQVP SPLVPTRENY FVRYCKQHAD GTWAVVDVSL DNLRPSFISR SRRRPSGCLI  420
QELPNGYSKV IWIEHVEVDD RAVHSIYRPL VNSGIAFGAK RWLATLDRQC ERLTSSMANN  480
IPAGDLCVIT STEGRKSMLK LAERMVMSFC TGVGASTAHA WTTLSATGSD EVRVMTRKSM  540
DDPGRPPGIV LSAATSFWIP VPTKRVFDFL RYENSRTQWD ILSNGGLVQE MAHIANGRDQ  600
GNCVSLLRVN SANSSQSNML ILQESCTDST GSYVIYAPVD IVAMNVVLSG GDPDYVALLP  660
SGFAILPDGP AGVNGGGILG VGSGGSLLTV AFQILVDSVP TAKLSLGSVA TVNSLIKCTV  720
ERIKAAVMCE NS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026002.10.0Protodermal factor 2 isoform 1
RefseqXP_007026003.10.0Protodermal factor 2 isoform 1
RefseqXP_007026004.10.0Protodermal factor 2 isoform 1
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A061GGE70.0A0A061GGE7_THECC; Protodermal factor 2 isoform 1
STRINGVIT_10s0116g00680.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2