PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00023566-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 467aa    MW: 51073.7 Da    PI: 8.3882
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00023566-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.46e-32249304156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  WALNUT_00023566-RA 249 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 304
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.96E-17246307IPR009057Homeodomain-like
PROSITE profilePS5129413.355246306IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-28247307IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-26249304IPR006447Myb domain, plants
PfamPF002498.2E-7251302IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MASPLELSLD FKPHSYSMLL KSFGGQSEQT QKLEDFLSRL EEERLKIDAF KRELPLCMQL  60
LSNALEAHRQ QLRAYRSANQ GPRPVLEEFI PLKQSTSESS EKSSNNSDKA NWMTSAQLWS  120
QASDGTKPQS TILFHKEPEI GLDTCPKLAL DNKQRNGGAF HPFSKERNSF PSPNLRALPD  180
LALASAERQL EDKKCLETEN GISSPRREDT GKGGSGGVGA EQAKRPGNSS DGQTTATTTA  240
PSTNQTHRKA RRCWSPDLHR RFVNALQMLG GSQVATPKQI RELMKVDGLT NDEVKSHLQK  300
YRLHTRRPSP NPQTAGAQAT QLVVLGGIWV PPEYATAAAA AAHTGASALY GAHPASHAQP  360
HYCGPGVPQE FYAAPPPPPH GHQLHHHSLH HQLHVYNATC QTHSSPQSDA RGARDLYRSE  420
SIEDGKSDSS SWKGESGDNG GERKGLGALR RDQDGEESNG SGITLKF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010656386.10.0PREDICTED: uncharacterized protein LOC100250892
TrEMBLF6HH570.0F6HH57_VITVI; Putative uncharacterized protein
STRINGVIT_11s0016g04600.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-115G2-like family protein