PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00022986-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 415aa    MW: 46390.9 Da    PI: 8.316
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00022986-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.32e-29246300155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWt++LHe+Fv +v+ LGG+e AtPk+il+lm+ +gLt+ hvkSHLQkYR 
  WALNUT_00022986-RA 246 KTRIRWTQDLHEKFVGCVNYLGGAESATPKAILNLMGSDGLTIFHVKSHLQKYRN 300
                         68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.058243303IPR017930Myb domain
SuperFamilySSF466892.69E-15244300IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-26244301IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-22246301IPR006447Myb domain, plants
PfamPF002491.6E-6250299IPR001005SANT/Myb domain
PfamPF143797.2E-21331377IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MNAKKIDCQE PVSQNFGVIT DCNSEFASLS SQLSGFKQPW HLGTCAQPQA MGGGSQQQYI  60
RPAKSSSTIM SRFESPASAF YATERCMGFP QYNRQAGDPS LCSRFPRTYD SQFPSYPSSG  120
EDFSIDSAYQ ADSNVDMRNT LQAMLKTQFS GSQYNGSSSI NSPGCKLLPH EQNKFLVDDT  180
TCGGRNLLLP LKRNRDHMGN YNSYNCLFPQ LSFSSPQEKQ SPRLSPENIS VTAGNTASPG  240
AVLSNKTRIR WTQDLHEKFV GCVNYLGGAE SATPKAILNL MGSDGLTIFH VKSHLQKYRN  300
AKYMPESTEG KSEKRNSMGN VPRLDDKTDL QIREALHLQL DVQRRLHEQL EVQRHLQLRI  360
EEQGRQLKMM FDQQQKTNIS LFQIHNLDTS FAQSSDVQVS ISEGSLNSHL PSKIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015898947.11e-148PREDICTED: uncharacterized protein LOC107432339 isoform X3
TrEMBLA0A061F4K81e-146A0A061F4K8_THECC; Myb-like HTH transcriptional regulator family protein, putative isoform 1
STRINGPOPTR_0006s20540.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-70G2-like family protein