PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00022627-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 356aa    MW: 39689.7 Da    PI: 7.6217
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00022627-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.12.5e-301569155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+W peLH+rF eav+qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  WALNUT_00022627-RA 15 KPRLKWIPELHQRFTEAVDQLGGADKATPKSLMRVMGIPGLTLYHLKSHLQKYRL 69
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.6E-291372IPR009057Homeodomain-like
SuperFamilySSF466892.15E-141470IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-211570IPR006447Myb domain, plants
PfamPF002499.8E-61768IPR001005SANT/Myb domain
PfamPF143791.7E-22113159IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MQNQNMNLVL STDAKPRLKW IPELHQRFTE AVDQLGGADK ATPKSLMRVM GIPGLTLYHL  60
KSHLQKYRLG KSQLPESCTD NKEEDHREIK TNDGHLSRDI SDATKNQINE NLQIAQALQL  120
QMEVQRKLHE QIEVQRHLQL RIEAQGKYLQ SVLKKAQETL SGYNSSPLGV ELAKAELSQL  180
VSMVNTGCPS SSVSELTETG DLSLKDVERK QVRGTICSME SSLTSSESSG RKEEKRPMKD  240
SGDPQMSNTT ALELSLMDLH PEDKPRRTDA SNQGSGRKRS GSAISDGICA EQPVSKRSPT  300
LRDKSGNPLR KSGLLEKLDL NSHYQHDIES GPKAIDLNIK GIELCNGWNL DNTDRF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895130.11e-180PREDICTED: uncharacterized protein LOC107429021 isoform X1
TrEMBLW9SPH91e-165W9SPH9_9R
STRINGVIT_01s0026g02550.t011e-157(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52183253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.12e-84G2-like family protein