PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00022503-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 371aa    MW: 41129.9 Da    PI: 7.993
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00022503-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32260313255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  WALNUT_00022503-RA 260 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 313
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15257313IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28258313IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23260313IPR006447Myb domain, plants
PfamPF002492.4E-7261312IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MPLEGIFIEP SSTPLPDLSL HISPPNSSSS SICTISNELD TRFDLLSQRE AHNSNSNISE  60
RTESQAHTEL SLGRNSRCGA EEAPHKPYQQ QRHLLYQSNN HLNHINHGVS LLDVSSDGLT  120
PIKGIPIYHS RSFPFLPMDP TRDKDPKMCF YQNPSYPSLS SSCSSLCTPS VSHSPSSYYG  180
GGLDPMSILN SVPNASSAAF RLGATTRFNG FSADAFKSQQ LHHHHDHHNQ YGIGPSEASH  240
GMMRSRFLPK LPTKRSMRAP RMRWTTTLHA RFVHAVELLG GHERATPKSV LELMDVKDLT  300
LAHVKSHLQM YRTVKTTDKP AASSDELISP MGSACDHGLR PFADQRGQAD QRPIQQDVDY  360
PSSSLWSNSS R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-17261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-17261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-17261315357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-17261315357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-17261315357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-17261315357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-17261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-17261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-17261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-17261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-17261315458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-17261315458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018847093.10.0PREDICTED: transcription repressor KAN1-like isoform X1
RefseqXP_018847094.10.0PREDICTED: transcription repressor KAN1-like isoform X2
TrEMBLA0A2I4GT680.0A0A2I4GT68_JUGRE; transcription repressor KAN1-like isoform X1
TrEMBLA0A2I4GT780.0A0A2I4GT78_JUGRE; transcription repressor KAN1-like isoform X2
STRINGVIT_04s0043g00340.t011e-152(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-61G2-like family protein