PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00022180-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family GeBP
Protein Properties Length: 418aa    MW: 45552.5 Da    PI: 6.0909
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00022180-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573133.29.1e-42178274197
              DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                         klfqrlwse+Dei++L+Gl+d+++k+g++p+ d  af+efvkks++++vsk+ql++KirrL+kK+k++  + k+gkep+fsk+h+qk++el
  WALNUT_00022180-RA 178 KLFQRLWSEDDEIAILKGLLDYTEKRGADPFTDAAAFHEFVKKSLHVDVSKNQLMDKIRRLRKKYKNNAGRGKKGKEPTFSKPHEQKAYEL 268
                         579**************************************************************************************** PP

              DUF573  92 skkiWg 97 
                         skkiWg
  WALNUT_00022180-RA 269 SKKIWG 274
                         *****9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.7E-37180274IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MAPKRQSHLD DPPAASSSEE EVASSEEEEE EHEDEEEGSA SSEEEAEPTK TSSLPSTPLP  60
DKKAPSKKPD PPLTKPQSSS SGSGSESESE SDSGATPNPT VKPIASKPME DAAPKATTKP  120
RSKPSSTTPA RSVATKRPNN ETDIKDSSKR AKKKAPEPNT DGAVSPGDSK KSAGEEKKLF  180
QRLWSEDDEI AILKGLLDYT EKRGADPFTD AAAFHEFVKK SLHVDVSKNQ LMDKIRRLRK  240
KYKNNAGRGK KGKEPTFSKP HEQKAYELSK KIWGPAEGTG GGGGVEDGKS NGKAASRKNN  300
QKVNTGRSLK DELLAVSPIA NKEVEKMDND GNPGLGSDSL RSLDEVVRFD KNMSVAGLEE  360
GVIKRGLELI GKDKRAELEE RWKEVQMAEL EVFVKRTELI RDQARLILEA YKAAENDH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018805542.10.0PREDICTED: probable transcription factor At1g61730
TrEMBLA0A2I4DEH00.0A0A2I4DEH0_JUGRE; probable transcription factor At1g61730
STRINGXP_008439944.11e-107(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-37DNA-binding storekeeper protein-related transcriptional regulator