PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00021544-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 255aa    MW: 27457.7 Da    PI: 7.7965
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00021544-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.72.6e-3346100155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  WALNUT_00021544-RA  46 KQRLRWTSDLHDRFVDAISQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 100
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6143103IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-3145101IPR009057Homeodomain-like
SuperFamilySSF466892.33E-1745100IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-2646101IPR006447Myb domain, plants
PfamPF002495.4E-84899IPR001005SANT/Myb domain
PfamPF143794.4E-25134180IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MTSLVPHKGQ GGGGEPVSTG AGVSGGCATV VIKNSTPAAS AGGTGKQRLR WTSDLHDRFV  60
DAISQLGGPD RATPKGVLRV MGVPGLTIYH VKSHLQKYRL AKYLPESPGD GKGFNDEKKS  120
SGDSLSATDS SPGMQINEAL RMQMEVQKRL HEQLEVQRQL QMRIEAQGKY LQKIIEEQQK  180
IGGAPEASET SALDDDKQKT SHSESPGDDS AGPSSPQKKQ MVDDGLTVGL ASSATPKRDQ  240
NKEFVNHWDQ ELLWK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008392505.11e-115PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ8GUN53e-52PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLM5VRH61e-111M5VRH6_PRUPE; Uncharacterized protein
STRINGGLYMA19G30220.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130132330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-67G2-like family protein