PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00021290-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 236aa    MW: 26838 Da    PI: 8.1939
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00021290-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-1963116356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+ ++t++ql+ Le+ F+++ +++ +++ +L+k+lgL+ rq+ vWFqNrRa++k
  WALNUT_00021290-RA  63 KKKRLTSDQLDSLERSFQEEIKLDPDRKMKLSKELGLQPRQIAVWFQNRRARWK 116
                         56779************************************************9 PP

2HD-ZIP_I/II119.41.9e-3862153192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekk+rl+++q+ +LE+sF+ee kL+p+rK++l++eLglqprq+avWFqnrRAR+k+kqlE+ y+aLk+ yd +++e+++L++ev +L++ l
  WALNUT_00021290-RA  62 EKKKRLTSDQLDSLERSFQEEIKLDPDRKMKLSKELGLQPRQIAVWFQNRRARWKAKQLEHLYDALKQDYDVISRERQKLQEEVMKLKAML 152
                         69**************************************************************************************887 PP

         HD-ZIP_I/II  92 k 92 
                         +
  WALNUT_00021290-RA 153 R 153
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.12E-1947120IPR009057Homeodomain-like
PROSITE profilePS5007117.21658118IPR001356Homeobox domain
SMARTSM003895.1E-1861122IPR001356Homeobox domain
CDDcd000861.41E-1663119No hitNo description
PfamPF000469.4E-1763116IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-2164125IPR009057Homeodomain-like
PRINTSPR000313.7E-58998IPR000047Helix-turn-helix motif
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
PRINTSPR000313.7E-598114IPR000047Helix-turn-helix motif
PfamPF021831.4E-8118152IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MDWNGSLIRP FVTRPESSLS FLYNYNYDHF PGMEVKHPAV VDSAHGMVPT MDKNSNYGSC  60
QEKKKRLTSD QLDSLERSFQ EEIKLDPDRK MKLSKELGLQ PRQIAVWFQN RRARWKAKQL  120
EHLYDALKQD YDVISRERQK LQEEVMKLKA MLRSEQQAGG RKQAGSTGYT EISGEETVES  180
TSIAINGSNK TRSGGGGGSA SQHHQINADC NYLFNVEEYN PLSPPYWPGG LPSYPS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110118RRARWKAKQ
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018836200.11e-179PREDICTED: homeobox-leucine zipper protein ATHB-22-like isoform X1
RefseqXP_018836201.11e-179PREDICTED: homeobox-leucine zipper protein ATHB-22-like isoform X1
SwissprotQ9LZR06e-52ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLA0A2I4FX261e-177A0A2I4FX26_JUGRE; homeobox-leucine zipper protein ATHB-22-like isoform X1
STRINGEOY080751e-116(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33943466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.13e-54homeobox 51
Publications ? help Back to Top
  1. Andres RJ, et al.
    Modifications to a LATE MERISTEM IDENTITY1 gene are responsible for the major leaf shapes of Upland cotton (Gossypium hirsutum L.).
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(1): p. E57-E66
    [PMID:27999177]
  2. Vuolo F, et al.
    LMI1 homeodomain protein regulates organ proportions by spatial modulation of endoreduplication.
    Genes Dev., 2018. 32(21-22): p. 1361-1366
    [PMID:30366902]