PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00021284-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 226aa    MW: 26120.4 Da    PI: 6.9623
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00021284-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.3e-1961114356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+ ++t++ql+ Le+ F+++ +++ +++ +L+k+lgL+ rq+ vWFqNrRa++k
  WALNUT_00021284-RA  61 KKKRLTSDQLDSLERSFQEEIKLDPDRKMKLSKELGLQPRQIAVWFQNRRARWK 114
                         56679************************************************9 PP

2HD-ZIP_I/II119.51.8e-3861151292
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         kk+rl+++q+ +LE+sF+ee kL+p+rK++l++eLglqprq+avWFqnrRAR+k+kqlE+ y+aLk+ yd +++++++L++ev +L++ l+
  WALNUT_00021284-RA  61 KKKRLTSDQLDSLERSFQEEIKLDPDRKMKLSKELGLQPRQIAVWFQNRRARWKAKQLEQLYDALKQDYDVISRDKQKLQEEVMKLKAMLS 151
                         9**************************************************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.08E-1943118IPR009057Homeodomain-like
PROSITE profilePS5007117.0756116IPR001356Homeobox domain
SMARTSM003891.7E-1759120IPR001356Homeobox domain
CDDcd000861.15E-1661117No hitNo description
PfamPF000466.2E-1761114IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-2163123IPR009057Homeodomain-like
PRINTSPR000313.5E-58796IPR000047Helix-turn-helix motif
PROSITE patternPS00027091114IPR017970Homeobox, conserved site
PRINTSPR000313.5E-596112IPR000047Helix-turn-helix motif
PfamPF021832.3E-8116150IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MDWNGSSRPF VSQPESSLSF LYNYNYDHFP VMEVKHPAMV DLEHGMVPAM DKNNYGSFQD  60
KKKRLTSDQL DSLERSFQEE IKLDPDRKMK LSKELGLQPR QIAVWFQNRR ARWKAKQLEQ  120
LYDALKQDYD VISRDKQKLQ EEVMKLKAML SEQAAGRKQV STGYTEISGE ETVESTSVAI  180
NIGSNIKPKP RGASQHQISD CNYLFNVEEY NPVSPPYWAT LPSYPS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108116RRARWKAKQ
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018836203.11e-169PREDICTED: homeobox-leucine zipper protein ATHB-22
SwissprotQ9LZR02e-56ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLA0A2I4FX251e-168A0A2I4FX25_JUGRE; homeobox-leucine zipper protein ATHB-22
STRINGXP_002528635.11e-117(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33943466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.17e-59homeobox 51
Publications ? help Back to Top
  1. Andres RJ, et al.
    Modifications to a LATE MERISTEM IDENTITY1 gene are responsible for the major leaf shapes of Upland cotton (Gossypium hirsutum L.).
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(1): p. E57-E66
    [PMID:27999177]
  2. Vuolo F, et al.
    LMI1 homeodomain protein regulates organ proportions by spatial modulation of endoreduplication.
    Genes Dev., 2018. 32(21-22): p. 1361-1366
    [PMID:30366902]