PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00020371-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 823aa    MW: 89275.6 Da    PI: 6.3847
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00020371-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.8e-21120175156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  WALNUT_00020371-RA 120 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 175
                         688999***********************************************999 PP

2START210.46.5e-663295531206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela++a++elvk+a+ +e +Wv+s     e++n +e+l++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    +
  WALNUT_00020371-RA 329 ELALAAMDELVKMAQTDESLWVRSLegrrEMLNLEEYLRTFTPCIGmkpngFVTEASRETGMVIINSLALVETLMDSN-RWAEMFPcmiaR 418
                         5899**************************************9988999*9***************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                          +t++vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+ds ++ +  + +v +++lpSg+++++++ng+s
  WALNUT_00020371-RA 419 TSTTDVISSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDSIRETSAAPTFVNCRRLPSGCVVQDMPNGYS 509
                         ****************************************************************999************************ PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kvtwveh++++++++h+l+r+l++sg+ +ga++w atlqrqce+
  WALNUT_00020371-RA 510 KVTWVEHAEYDESQVHQLYRPLLSSGMGFGAQRWIATLQRQCEC 553
                         ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.15E-20103177IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-21112177IPR009057Homeodomain-like
PROSITE profilePS5007117.248117177IPR001356Homeobox domain
SMARTSM003892.2E-17118181IPR001356Homeobox domain
CDDcd000861.87E-18119177No hitNo description
PfamPF000462.0E-18120175IPR001356Homeobox domain
PROSITE patternPS000270152175IPR017970Homeobox, conserved site
PROSITE profilePS5084845.088320556IPR002913START domain
SuperFamilySSF559613.5E-34322553No hitNo description
CDDcd088751.76E-127324552No hitNo description
PfamPF018521.0E-57329553IPR002913START domain
SMARTSM002344.6E-51329553IPR002913START domain
SuperFamilySSF559611.33E-23575809No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 823 aa     Download sequence    Send to blast
MSFGGFLENT TGGGARVVAD ISYNNSNGNN NHNMPAGALA HPRLVTPPLT KSMFNSSPGL  60
SLGLQPNIDG QADVARMAEN FEVNLGRRSR DEEHESRSGS DNMDGASGDD LDAADNPPRK  120
KRYHRHTPQQ IQELESLFKE CPHPDEKQRL ELSKRLCLET RQVKFWFQNR RTQMKTQLER  180
HENSLLRQEN DKLRAENMSI RDAMRNPICS NCGGPAIIGE ISLEEQHLRI ENARLKDELD  240
RVCALAGKFL GRPISSLANA IGPPLPSSSL ELGVGSNGFA GLSHVATTLP LGPDFGVGIS  300
GVLPVVPPAR PPSSLTGLDR SIERSMFLEL ALAAMDELVK MAQTDESLWV RSLEGRREML  360
NLEEYLRTFT PCIGMKPNGF VTEASRETGM VIINSLALVE TLMDSNRWAE MFPCMIARTS  420
TTDVISSGMG GTRNGALQLM HAELQVLSPL VPVREVNFLR FCKQHAEGVW AVVDVSIDSI  480
RETSAAPTFV NCRRLPSGCV VQDMPNGYSK VTWVEHAEYD ESQVHQLYRP LLSSGMGFGA  540
QRWIATLQRQ CECLAILMSS TVPARDHTAA ITAGGRRSML KLAQRMTDNF CAGVCASTVH  600
KWNKLQAGNV DEDVRVMTRK SVDDPGEPPG IVLSAATSVW LPVSPQKLFD FLRDERLRSE  660
WDILSNGGPM QEMAHIAKGQ DHGNCVSLLR AGAMNANQSS MLILQETCID AAGSLVVYAP  720
VDIPAMHVVM NGGDSAYVAL LPSGFAIVPD GPGSRGPGTA TANGGGGAGP GPHRVSGSLL  780
TVAFQILVNS LPTAKLTVES VETVNNLISC TVQKIKAALQ CES
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018813891.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2I4E3B10.0A0A2I4E3B1_JUGRE; homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
STRINGPOPTR_0014s07130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]