PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00019432-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 278aa    MW: 31087.3 Da    PI: 8.3248
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00019432-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.9e-19130184256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  WALNUT_00019432-RA 130 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 184
                         788899***********************************************98 PP

2HD-ZIP_I/II125.13.2e-40130219191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  WALNUT_00019432-RA 130 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELHELK-AL 219
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-18118180IPR009057Homeodomain-like
SuperFamilySSF466895.43E-19119187IPR009057Homeodomain-like
PROSITE profilePS5007117.589126186IPR001356Homeobox domain
SMARTSM003891.0E-15128190IPR001356Homeobox domain
CDDcd000861.39E-17130187No hitNo description
PfamPF000463.1E-16130184IPR001356Homeobox domain
PROSITE patternPS000270161184IPR017970Homeobox, conserved site
SMARTSM003406.2E-25186229IPR003106Leucine zipper, homeobox-associated
PfamPF021838.2E-10186220IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGFDDHIVCN TGLVLGLGLT SATYEEVPSP SKAGPPKKPC LNFTTTNFEP SLTLGLSGEG  60
YGHQVPKKID VNRGCDEPVD LYRQTSPHSA VSSFSSGRVK RERDLSSEEI EVERVSSRVS  120
DEDEDGPNAR KKLRLTKEQS ALLEESFKQH STLNPKQKQA LARQLNLRPR QVEVWFQNRR  180
ARTKLKQTEV DCEFLKKCCE TLTDENRRLQ KELHELKALK LAQPLYMHMP AATLTMCPSC  240
ERIGSGVVGE NASKISTFSM APKSHFYNPF MTNPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178186RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007047635.11e-145Homeodomain-leucine zipper protein HD4
RefseqXP_015890394.11e-145PREDICTED: homeobox-leucine zipper protein HAT22
SwissprotP466041e-103HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A061DHW31e-145A0A061DHW3_THECC; Homeodomain-leucine zipper protein HD4
STRINGVIT_00s0732g00010.t011e-139(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.16e-85HD-ZIP family protein