PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00019251-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 755aa    MW: 83490.9 Da    PI: 5.4841
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00019251-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox43.17e-1449842156
                        HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        ++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  WALNUT_00019251-RA 49 ECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 84
                        689******************************998 PP

2START163.81.3e-512334602206
                         HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS..............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
               START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv.............dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                         la + ++elvk+   +ep+W +    eng evl  +e ++               ++ea+r+s+vv+m++ +lv  +ld + +W e ++  
  WALNUT_00019251-RA 233 LAVSSMDELVKMCRGTEPLWIRNN--ENGREVLNLEEHARMfpwplnlrhhsneLRTEASRDSAVVIMNSITLVDAFLDAN-KWMELFPsi 320
                         78899*****************99..**********99888****************************************.********* PP

                         ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE...TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEE CS
               START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirq..lgagdwvivdvSvdseqkppesssvvRaellpSgiliepk 157
                           +a+t++v+ssg      g lqlm+aelq+lsplvp R+  f+Ry++q  ++ag+w+ivd  +ds  ++ + +s+ R +++pSg+li+++
  WALNUT_00019251-RA 321 vsRAKTVQVLSSGdsghasGSLQLMYAELQVLSPLVPtREGHFLRYCQQnaEEAGTWAIVDFPIDSFHDNLQRPSFPRYKRRPSGCLIQDM 411
                         *********************************************************************988******************* PP

                         CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         +ng+s+vtw+eh++++++ +h+ +  +v sg+a+ga++w+a lqrqce+
  WALNUT_00019251-RA 412 PNGYSRVTWIEHAEVEEKPVHQFFSDFVYSGMAFGAQRWLAVLQRQCER 460
                         ***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.4E-64290IPR001356Homeobox domain
CDDcd000862.36E-124887No hitNo description
SuperFamilySSF466899.19E-124987IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-134992IPR009057Homeodomain-like
PfamPF000462.1E-114984IPR001356Homeobox domain
PROSITE profilePS5007113.075186IPR001356Homeobox domain
PROSITE patternPS0002706184IPR017970Homeobox, conserved site
PROSITE profilePS5084845.407223463IPR002913START domain
SuperFamilySSF559614.4E-31224462No hitNo description
CDDcd088753.75E-125227459No hitNo description
SMARTSM002342.7E-36232460IPR002913START domain
PfamPF018521.0E-43233460IPR002913START domain
SuperFamilySSF559611.51E-18478657No hitNo description
SuperFamilySSF559611.51E-18684721No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MYGDCQVMPT MAGNVVSSES LFSSPPIQNP SFNFMPGMPF QTFPPMIAEC PHPDDKQRLK  60
LSQELGLKPR QVKFWFQNRR TQMKAQQDRT DNAILKVENE TLRQENFRLQ RALSNVVCPN  120
CGGPCMIGGE MGLDEQQLRL ENSRLREELE RVSSCLASQY AGRPIEAMQA AATFMPPPSL  180
DLDMNIYSRH FQDPMASCTD MTPVPMLMPP ETAYHFPEAG LLLEEEKPIA LELAVSSMDE  240
LVKMCRGTEP LWIRNNENGR EVLNLEEHAR MFPWPLNLRH HSNELRTEAS RDSAVVIMNS  300
ITLVDAFLDA NKWMELFPSI VSRAKTVQVL SSGDSGHASG SLQLMYAELQ VLSPLVPTRE  360
GHFLRYCQQN AEEAGTWAIV DFPIDSFHDN LQRPSFPRYK RRPSGCLIQD MPNGYSRVTW  420
IEHAEVEEKP VHQFFSDFVY SGMAFGAQRW LAVLQRQCER VASLMARNIS DLGVIPSPEA  480
RKNLMKLAQR MVRTFCVNIS TSSGLIWTAL SDSPDDTVRI ATRKITEPGQ PNGLILCAVS  540
STWLPYPHNH VFGLLRDERR RSQLDVISNG NSLHEVAHIA NGSHPGNCVS LLRINVASNS  600
SQHVELMLQE SCTDDSGSLV VYTTIDVDSI QLAMSGEDPS CIPLLPMGFV IVPVGSTGET  660
TNISGDGNPN IPSSEEGNSP TSSGCLLTVV VQDLVSTIPS AKLNLSSVNS INNHLCNALH  720
QITAALSSTI SKTSCPDNAS ALGSCTEPTS APPKH
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4279444e-38AM427944.2 Vitis vinifera contig VV78X076481.6, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018840870.10.0PREDICTED: homeobox-leucine zipper protein HDG5-like, partial
SwissprotQ336P20.0ROC3_ORYSJ; Homeobox-leucine zipper protein ROC3
SwissprotQ9FJS20.0HDG5_ARATH; Homeobox-leucine zipper protein HDG5
TrEMBLA0A2I4GAH50.0A0A2I4GAH5_JUGRE; homeobox-leucine zipper protein HDG5-like
STRINGXP_007158253.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109463036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Lung SC, et al.
    Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
    New Phytol., 2018. 218(1): p. 183-200
    [PMID:29288621]
  4. Chou IT,Gasser CS
    Characterization of the cyclophilin gene family of Arabidopsis thaliana and phylogenetic analysis of known cyclophilin proteins.
    Plant Mol. Biol., 1997. 35(6): p. 873-92
    [PMID:9426607]