PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00018990-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 222aa    MW: 24879.6 Da    PI: 9.4559
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00018990-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.31.5e-1975129256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ ++tkeq + Lee F++n++++ +++e LA++l L+ rqV vWFqNrRa+ k
  WALNUT_00018990-RA  75 RKKLRLTKEQSRLLEESFRQNHTLNPKQKENLAMQLMLKPRQVEVWFQNRRARSK 129
                         78889************************************************98 PP

2HD-ZIP_I/II116.51.6e-3775163189
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                         +kk+rl+keq++lLEesF+++++L+p++K++la +L l+prqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL++eveeLr+
  WALNUT_00018990-RA  75 RKKLRLTKEQSRLLEESFRQNHTLNPKQKENLAMQLMLKPRQVEVWFQNRRARSKLKQTEMECEFLKRRFGSLTEQNRRLQREVEELRA 163
                         69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.06E-1960132IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-1863125IPR009057Homeodomain-like
PROSITE profilePS5007117.31371131IPR001356Homeobox domain
SMARTSM003894.3E-1873135IPR001356Homeobox domain
CDDcd000862.04E-1774132No hitNo description
PfamPF000467.3E-1775129IPR001356Homeobox domain
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PfamPF021835.5E-9131165IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.9E-20131174IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MAVLPSSPSS LELTISMPGF ASSQSLPPSG FKSEVICAVR NLDINQVPSG GVEEDQWITM  60
NMEDEEESSN GGPPRKKLRL TKEQSRLLEE SFRQNHTLNP KQKENLAMQL MLKPRQVEVW  120
FQNRRARSKL KQTEMECEFL KRRFGSLTEQ NRRLQREVEE LRAMKVGPPT VISPNSCEPL  180
PASTLSMCPR CERVTSNAAL INKGPTKTAT TTLSTKVAVP PL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123131RRARSKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018835887.11e-160PREDICTED: homeobox-leucine zipper protein HOX3-like isoform X1
SwissprotQ0JKX16e-82HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH386e-82HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A2I4FW591e-159A0A2I4FW59_JUGRE; homeobox-leucine zipper protein HOX3-like isoform X1
STRINGcassava4.1_022041m1e-116(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95063040
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.18e-77homeobox-leucine zipper protein 17