PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00018692-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family CPP
Protein Properties Length: 633aa    MW: 69377.1 Da    PI: 8.1929
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00018692-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR52.11.3e-16209246340
                 TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++CnCkk+kClk+YCeCfaag +C+e+C+C++C N+ 
  WALNUT_00018692-RA 209 DRHCNCKKTKCLKLYCECFAAGIYCAESCTCQGCYNRP 246
                         689*********************************86 PP

2TCR49.86.9e-16304342139
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                         k+k+gCnCkks ClkkYCeC++a++ Cs+ C+C++CkN 
  WALNUT_00018692-RA 304 KHKRGCNCKKSMCLKKYCECYQAKVGCSSGCRCDGCKNV 342
                         589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.6E-15207248IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163433.962208344IPR005172CRC domain
PfamPF036385.1E-13210245IPR005172CRC domain
SMARTSM011149.4E-17304345IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-11306341IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MAGSTEYYWK QSHSFDPAGK VTNSRSPTMN EELESLESSP AYLNATSSNG KMVQLSQFRP  60
NSFPLQYSGT SSLPVSKPSG IGLHLNSIAN TVPITYGATA NMKLQEDYMG VRGMESASAC  120
CPISSNAVGK FSFIPKDVGG KSKIAASFAS SESPHITEPP NDKCKIISEQ TYNYEYSRLS  180
PKTKRQVAFL IVGLTTKLTK TSSTIDGDDR HCNCKKTKCL KLYCECFAAG IYCAESCTCQ  240
GCYNRPDYED TVLVTKQQIE SRNPLAFAPK IVQRVNEFNS MQLDSRIFHI QKDGNGATPS  300
SSGKHKRGCN CKKSMCLKKY CECYQAKVGC SSGCRCDGCK NVYGRKEECA ATELGMNKEI  360
VRDEIGKERF EGTFDKHLEG MATKSDLLHA KLYDPHNITP LTPAFQYESE PKSQIVSRSY  420
LPSPEVDSPL SSYVDSSKTS RTSNSSDMLL QANKESLSLG SYDWRLDYTN VEMMDQFSPE  480
SDTVALSQLT SLSDLPFMAM ASSTSFKTRD LASSSHFQHS PETGYVSSAG SHHWWSSPIT  540
PMTSLEGTKS LQGLNPDGGF CDIPVYGSPD ILRAPDILRD RTTPSNSVKV RSPNQKRVSP  600
PQSHLNKLGS SSSGGLRTSG KFILRAAPSF PPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-1821234214121Protein lin-54 homolog
5fd3_B7e-1821234214121Protein lin-54 homolog
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023915620.10.0CRC domain-containing protein TSO1-like isoform X1
RefseqXP_023915623.10.0uncharacterized protein LOC112027180 isoform X3
TrEMBLA0A2N9F4E30.0A0A2N9F4E3_FAGSY; Uncharacterized protein
STRINGXP_008229954.11e-166(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85652841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.18e-53TESMIN/TSO1-like CXC 2