PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00018317-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family BBR-BPC
Protein Properties Length: 752aa    MW: 84301.1 Da    PI: 8.112
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00018317-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind26.22.2e-083777143
           GAGA_bind  1 mdddgsrernkgyyepaaslkenlglqlmssiaerdakirern 43
                        mddd+ + rn++yyep+  +k +lglqlmss+a+ d+   ++ 
  WALNUT_00018317-RA 37 MDDDALNMRNWAYYEPS--FKGHLGLQLMSSMADCDTTFSSQS 77
                        9***9999*******99..*****************9985544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.9E-537151IPR010409GAGA-binding transcriptional activator
PfamPF027315.1E-52352464IPR004015SKI-interacting protein SKIP, SNW domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000398Biological ProcessmRNA splicing, via spliceosome
GO:0005681Cellular Componentspliceosomal complex
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MSLGTYFRLE RSCYKNCTTS EEEEEEEEIF RWRAVVMDDD ALNMRNWAYY EPSFKGHLGL  60
QLMSSMADCD TTFSSQSNFW SSSLTDFTTT HSVKKRHSGY APEIPKAKML RKPRDKNNSS  120
VQLVKPAKKS MDVVINGIDM DISGIPISII MASLKELLPP VKSTTASSYD HSNDPWFKQR  180
FTSSEAEKSS VIKQNPVPPY LKRVGFVPRR VEDFVDGGAF PEIHLAQYPL DMGRDRSSKP  240
GSKILPVTVD AHGNVAYDAI VRQNENAKKT VYSQHKDLIP KVQKNDGEEQ EVDEEVEKEI  300
EETTLETKAA LEKIVNVRLS AAQPKNVPKQ SSETKFIKYK PSQQSAAFNS GAKERIIMMH  360
SPPRPVTVKD QQDWKIPPCI SNWKNPKGYT IPLDKRLAVD GRGLQDVQIN DNFAKLSEAL  420
YVAEQQAREA VAMRSKVQKE MMMKEKERKE QELRALAQKA RSERIGVAPP AAILIPSEKS  480
AMDGSDWRID YQHTKDKERD FPKETKDERE ERLRREKIRE ERRRERERER RLEAKDAAMG  540
KKSKITRDRD RDISEKVALG MASTGAGRGG EVMPKKDADA EMYGGADEQL ENIMKTDHFK  600
PDKGFTGVAE KAGTRDGPLE FEKVAEEADP FGLDQFLTEV KKGKKALDKV GTGGTMKAGA  660
GSSMRDGYEG GSSRTRIGFE RASLSQSSEF LSGMAHSSVQ SPLEFASGDD GGLKNPNPRF  720
CSPQDDLHPS PVVAPLVLGI SPTRNCDARD AS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5mqf_C1e-11119864242510SNW domain-containing protein 1
5xjc_R1e-11119864242510SNW domain-containing protein 1
5yzg_R1e-11119864242510SNW domain-containing protein 1
6ff4_C1e-11119864242510SNW domain-containing protein 1
6ff7_C1e-11119864242510SNW domain-containing protein 1
6icz_R1e-11119864242510SNW domain-containing protein 1
6id0_R1e-11119864242510SNW domain-containing protein 1
6id1_R1e-11119864242510SNW domain-containing protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtActs as positive regulator of drought and salt tolerance. Acts as positive regulator of cell viability. {ECO:0000269|PubMed:19339499}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, cold and salt stresses. Induced by wounding and treatment with abscisic acid (ABA), jasmonate (JA), salicylic acid (SA) and ethylene. {ECO:0000269|PubMed:19339499}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018814813.10.0PREDICTED: SNW/SKI-interacting protein-like
RefseqXP_018814818.10.0PREDICTED: SNW/SKI-interacting protein-like
SwissprotQ6K8D90.0SKIPA_ORYSJ; SNW/SKI-interacting protein A
TrEMBLA0A2I4E5Z50.0A0A2I4E5Z5_JUGRE; SNW/SKI-interacting protein-like
STRINGcassava4.1_003972m0.0(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.21e-10basic pentacysteine1
Publications ? help Back to Top
  1. Hou X,Xie K,Yao J,Qi Z,Xiong L
    A homolog of human ski-interacting protein in rice positively regulates cell viability and stress tolerance.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(15): p. 6410-5
    [PMID:19339499]
  2. Shen J,Xie K,Xiong L
    Global expression profiling of rice microRNAs by one-tube stem-loop reverse transcription quantitative PCR revealed important roles of microRNAs in abiotic stress responses.
    Mol. Genet. Genomics, 2010. 284(6): p. 477-88
    [PMID:20941508]
  3. Ning Y,Xie Q,Wang GL
    OsDIS1-mediated stress response pathway in rice.
    Plant Signal Behav, 2011. 6(11): p. 1684-6
    [PMID:22067990]
  4. Zhang YP, et al.
    A comparative study of stress-related gene expression under single stress and intercross stress in rice.
    Genet. Mol. Res., 2015. 14(2): p. 3702-17
    [PMID:25966139]
  5. Qin Y,Shen X,Wang N,Ding X
    Characterization of a novel cyclase-like gene family involved in controlling stress tolerance in rice.
    J. Plant Physiol., 2015. 181: p. 30-41
    [PMID:25974367]