PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00018317-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family BBR-BPC
Protein Properties Length: 752aa    MW: 84301.1 Da    PI: 8.112
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00018317-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind26.22.2e-083777143
           GAGA_bind  1 mdddgsrernkgyyepaaslkenlglqlmssiaerdakirern 43
                        mddd+ + rn++yyep+  +k +lglqlmss+a+ d+   ++ 
  WALNUT_00018317-RA 37 MDDDALNMRNWAYYEPS--FKGHLGLQLMSSMADCDTTFSSQS 77
                        9***9999*******99..*****************9985544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.9E-537151IPR010409GAGA-binding transcriptional activator
PfamPF027315.1E-52352464IPR004015SKI-interacting protein SKIP, SNW domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000398Biological ProcessmRNA splicing, via spliceosome
GO:0005681Cellular Componentspliceosomal complex
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MSLGTYFRLE RSCYKNCTTS EEEEEEEEIF RWRAVVMDDD ALNMRNWAYY EPSFKGHLGL  60
QLMSSMADCD TTFSSQSNFW SSSLTDFTTT HSVKKRHSGY APEIPKAKML RKPRDKNNSS  120
VQLVKPAKKS MDVVINGIDM DISGIPISII MASLKELLPP VKSTTASSYD HSNDPWFKQR  180
FTSSEAEKSS VIKQNPVPPY LKRVGFVPRR VEDFVDGGAF PEIHLAQYPL DMGRDRSSKP  240
GSKILPVTVD AHGNVAYDAI VRQNENAKKT VYSQHKDLIP KVQKNDGEEQ EVDEEVEKEI  300
EETTLETKAA LEKIVNVRLS AAQPKNVPKQ SSETKFIKYK PSQQSAAFNS GAKERIIMMH  360
SPPRPVTVKD QQDWKIPPCI SNWKNPKGYT IPLDKRLAVD GRGLQDVQIN DNFAKLSEAL  420
YVAEQQAREA VAMRSKVQKE MMMKEKERKE QELRALAQKA RSERIGVAPP AAILIPSEKS  480
AMDGSDWRID YQHTKDKERD FPKETKDERE ERLRREKIRE ERRRERERER RLEAKDAAMG  540
KKSKITRDRD RDISEKVALG MASTGAGRGG EVMPKKDADA EMYGGADEQL ENIMKTDHFK  600
PDKGFTGVAE KAGTRDGPLE FEKVAEEADP FGLDQFLTEV KKGKKALDKV GTGGTMKAGA  660
GSSMRDGYEG GSSRTRIGFE RASLSQSSEF LSGMAHSSVQ SPLEFASGDD GGLKNPNPRF  720
CSPQDDLHPS PVVAPLVLGI SPTRNCDARD AS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_M2e-7317746624341Pre-mRNA-processing protein 45
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004139354.10.0PREDICTED: SNW/SKI-interacting protein
RefseqXP_011648638.10.0PREDICTED: SNW/SKI-interacting protein
SwissprotO806530.0SKIP_ARATH; SNW/SKI-interacting protein
TrEMBLA0A0A0LIR80.0A0A0A0LIR8_CUCSA; Uncharacterized protein
STRINGVIT_11s0016g03290.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.21e-10basic pentacysteine1