PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00018057-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family GRAS
Protein Properties Length: 458aa    MW: 51180.6 Da    PI: 5.8478
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00018057-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.15.5e-92534552373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalkl..fsev 87 
                         ++lL++cA+a++s+d++laq++L+ l+++a pdgd++qRl+  f++AL ar a+  s+ +k l++ +++++n    ++++++ +l  f+++
  WALNUT_00018057-RA  53 EKLLVHCANAIESNDATLAQQILWVLNNIAPPDGDSNQRLTCGFLRALIARAAK--SGSCKMLAAVANAPSNlaiDTHKFSVIELasFVDL 141
                         789***************************************************..5556666555555555434444444444477**** PP

                GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvp 175
                         +P+++f++ +aN aIleaveg + +Hi+D+++++++Q p+L++a+a+R e pp +++T+  + e +      ++ee+g++L +fA + +v 
  WALNUT_00018057-RA 142 TPWHRFGFTAANAAILEAVEGYSVIHIVDLSLTHCMQIPTLIDAIANRHEVPPLVKLTVATAIEDFppkLDLSYEELGSKLVNFAMSKNVM 232
                         **********************************************************9999887787677899***************** PP

                GRAS 176 fefnvl...vakrledleleeLrvkp......gEalaVnlvlqlhrll...................desvsleserdevLklvkslsPkv 238
                         +ef+v    + + +++l +e+Lrv++       Eal++n++++lh+++                   +++ + +s r+ +L++v+sl P++
  WALNUT_00018057-RA 233 MEFRVSpssYKDGFATL-IEQLRVQHlvypesSEALVINCHMMLHYIPeetlvsipstnsnpyafecSSTSTASSFRTMFLSAVRSLDPTI 322
                         ****9777633334444.66666665666669**********************************87777777899************** PP

                GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpl 329
                         v++v++++d++s++ + r+ +a++y +  +d++++ lp+ s++r+++E+  + ++i+nv+a+eg +r+er et+++W +r+++a F+ v++
  WALNUT_00018057-RA 323 VILVDEDVDLTSNNVVCRLRSAFNYLWIPYDTMDTFLPKGSKQRQWYEAD-ICWKIENVIAHEGLQRVERLETKSQWVQRMRNANFHGVSF 412
                         **************************************************.**************************************** PP

                GRAS 330 sekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                         +e+a++++k++l +++  g+ +++e++ lvl+Wk++++v+++aW
  WALNUT_00018057-RA 413 GEEAVSEVKTMLDEHA-AGWGLKKEEEDLVLTWKGHNVVFATAW 455
                         ****************.899************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.21126437IPR005202Transcription factor GRAS
Gene3DG3DSA:1.25.10.102.3E-447129IPR011989Armadillo-like helical
PfamPF035141.9E-8953455IPR005202Transcription factor GRAS
Gene3DG3DSA:1.25.10.102.3E-4179198IPR011989Armadillo-like helical
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MMQFTEAPPQ PLHQMTPFSN PTMNKSQIHK TRPWLGFPTS KSLGSFGDAN CMEKLLVHCA  60
NAIESNDATL AQQILWVLNN IAPPDGDSNQ RLTCGFLRAL IARAAKSGSC KMLAAVANAP  120
SNLAIDTHKF SVIELASFVD LTPWHRFGFT AANAAILEAV EGYSVIHIVD LSLTHCMQIP  180
TLIDAIANRH EVPPLVKLTV ATAIEDFPPK LDLSYEELGS KLVNFAMSKN VMMEFRVSPS  240
SYKDGFATLI EQLRVQHLVY PESSEALVIN CHMMLHYIPE ETLVSIPSTN SNPYAFECSS  300
TSTASSFRTM FLSAVRSLDP TIVILVDEDV DLTSNNVVCR LRSAFNYLWI PYDTMDTFLP  360
KGSKQRQWYE ADICWKIENV IAHEGLQRVE RLETKSQWVQ RMRNANFHGV SFGEEAVSEV  420
KTMLDEHAAG WGLKKEEEDL VLTWKGHNVV FATAWLPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B5e-474845783474Protein SHORT-ROOT
5b3h_B1e-474845729420Protein SHORT-ROOT
5b3h_E1e-474845729420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018817387.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2I4EDA90.0A0A2I4EDA9_JUGRE; scarecrow-like protein 32
STRINGEOX916400.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein