PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00017271-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 327aa    MW: 36737.6 Da    PI: 4.7507
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00017271-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.7e-1958111356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++ +q+++Le+ Fe ++++  +++ +LA++lgL+ rqV vWFqNrRa++k
  WALNUT_00017271-RA  58 KKRRLSVDQVKALEKNFEVENKLEPDRKVKLAQELGLQPRQVAVWFQNRRARWK 111
                         566899***********************************************9 PP

2HD-ZIP_I/II128.82.2e-4157149193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls +qvk+LE++Fe e+kLep+rKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk +y+ lk + ++L++++e+L +e+
  WALNUT_00017271-RA  57 EKKRRLSVDQVKALEKNFEVENKLEPDRKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKGNYEGLKLNYDALQHDNEALLKEI 147
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ke
  WALNUT_00017271-RA 148 KE 149
                         87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.89E-1943115IPR009057Homeodomain-like
PROSITE profilePS5007117.0753113IPR001356Homeobox domain
SMARTSM003898.6E-1856117IPR001356Homeobox domain
PfamPF000465.0E-1658111IPR001356Homeobox domain
CDDcd000861.15E-1658114No hitNo description
Gene3DG3DSA:1.10.10.608.3E-2060119IPR009057Homeodomain-like
PRINTSPR000319.4E-68493IPR000047Helix-turn-helix motif
PROSITE patternPS00027088111IPR017970Homeobox, conserved site
PRINTSPR000319.4E-693109IPR000047Helix-turn-helix motif
PfamPF021831.3E-16113154IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MKRSLGSSDS LGALISICPT AEEHSPRNNH VYSREFQSML DGLDEEGCVE ETGHIAEKKR  60
RLSVDQVKAL EKNFEVENKL EPDRKVKLAQ ELGLQPRQVA VWFQNRRARW KTKQLERDYG  120
VLKGNYEGLK LNYDALQHDN EALLKEIKEL KAKLEKENAG STLSVKEEMF VHESDDQPME  180
QSKSAPDTPP LPASDSKDLH FDCLNHNING VGASLFQVDF KDGSSDSDSS AILNEDNSPN  240
AAISSSGGFL QNQQLLMSPA SSSLKFNCSS SSPSSSSITC FQFQKPFQTQ YVKTEEHNFF  300
SGEEACNIFS DEQAPTLQWY YPDPQWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105113RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011031070.11e-158PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform X1
TrEMBLA9PHT91e-158A9PHT9_POPTR; Uncharacterized protein
STRINGPOPTR_0007s05010.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.11e-66homeobox protein 6