PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00017068-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 240aa    MW: 27873.1 Da    PI: 4.7275
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00017068-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.28e-203589256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++++f++eq++ Le+lFe+++ +  +++ +LA++lgL+ rqV +WFqN+Ra++k
  WALNUT_00017068-RA 35 KNKRRFSDEQIRSLETLFESESRLEPRKKMQLATELGLQPRQVAIWFQNKRARWK 89
                        67789*************************************************9 PP

2HD-ZIP_I/II120.39.7e-3936127293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +krr+s+eq+++LE+ Fe+e++Lep++K++la+eLglqprqva+WFqn+RAR+k+kqlE++y+ L+++y++l++  ++L+ke+++L ++l+
  WALNUT_00017068-RA  36 NKRRFSDEQIRSLETLFESESRLEPRKKMQLATELGLQPRQVAIWFQNKRARWKSKQLEREYNILRANYNNLVSMFDALKKEKQALLQKLN 126
                         79************************************************************************************99997 PP

         HD-ZIP_I/II  93 e 93 
                         +
  WALNUT_00017068-RA 127 D 127
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.08E-191893IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-192492IPR009057Homeodomain-like
PROSITE profilePS5007118.0913191IPR001356Homeobox domain
SMARTSM003892.4E-163495IPR001356Homeobox domain
CDDcd000861.85E-143592No hitNo description
PfamPF000463.4E-173589IPR001356Homeobox domain
PRINTSPR000311.0E-56271IPR000047Helix-turn-helix motif
PROSITE patternPS0002706689IPR017970Homeobox, conserved site
PRINTSPR000311.0E-57187IPR000047Helix-turn-helix motif
PfamPF021831.5E-1391129IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MSIRLPIDHA EYAAAAEPFP CMDSFSTTMR KKNSKNKRRF SDEQIRSLET LFESESRLEP  60
RKKMQLATEL GLQPRQVAIW FQNKRARWKS KQLEREYNIL RANYNNLVSM FDALKKEKQA  120
LLQKLNDLMQ RPQEERQCCR QEPAANGIRG ESDNGDTATC EYEMKPSLST ERSEHGLGVL  180
TDEDACTKPE YFELEDEPTL LNIVEPTDST LASPEDWGSL NSESLFDQSN SNSQWWDFWS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAPTransfer from AT2G46680Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018805268.11e-172PREDICTED: homeobox-leucine zipper protein ATHB-12-like
SwissprotP468972e-66ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLA0A2I4DDP31e-170A0A2I4DDP3_JUGRE; homeobox-leucine zipper protein ATHB-12-like
STRINGPOPTR_0002s17680.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56353452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.12e-52homeobox 7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhou SF, et al.
    Membrane-associated transcription factor peptidase, site-2 protease, antagonizes ABA signaling in Arabidopsis.
    New Phytol., 2015. 208(1): p. 188-97
    [PMID:25919792]