PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00016982-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family BBR-BPC
Protein Properties Length: 233aa    MW: 25421.3 Da    PI: 10.6289
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00016982-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind229.52.7e-7072233136301
           GAGA_bind 136 pieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWG 226
                            +++ + ++ k++ k++++   k+ + k++kk++ k++k ++++   e ++++k   ++ +++ ++D s++P+P CsCtG+ r CYkWG
  WALNUT_00016982-RA  72 DSATKPAKGRKLKNSVKGSNQVASKVFRPKQTKKTP-KTTKGKSMP---EGKREKKILNNIHMEKADFDFSRVPPPYCSCTGVARLCYKWG 158
                         222333333333444444444444444444444433.222222222...2345555567899***************************** PP

           GAGA_bind 227 nGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         +GGWqS+CCt+++S yPLP+s++r+gaR+agrKmS+ga+ klL +LaaeG dl +pvDLkdhWA+HGtnkfv i+
  WALNUT_00016982-RA 159 AGGWQSSCCTINLSEYPLPMSSTRPGARVAGRKMSNGAYGKLLLRLAAEGCDLTHPVDLKDHWARHGTNKFVIIK 233
                         ************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012265.0E-6322233IPR010409GAGA-binding transcriptional activator
PfamPF062176.7E-6577233IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MGTYSNRNPM IPEATAGASV PHFTWFYPGS FLSASKTSSN PFQGVQLNAQ PSLPVGPIRT  60
IAVTPEPVND IDSATKPAKG RKLKNSVKGS NQVASKVFRP KQTKKTPKTT KGKSMPEGKR  120
EKKILNNIHM EKADFDFSRV PPPYCSCTGV ARLCYKWGAG GWQSSCCTIN LSEYPLPMSS  180
TRPGARVAGR KMSNGAYGKL LLRLAAEGCD LTHPVDLKDH WARHGTNKFV IIK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015901519.11e-106PREDICTED: protein BASIC PENTACYSTEINE7 isoform X2
RefseqXP_015901520.11e-106PREDICTED: protein BASIC PENTACYSTEINE7 isoform X2
SwissprotO822869e-68BPC7_ARATH; Protein BASIC PENTACYSTEINE7
TrEMBLA0A067L8I41e-104A0A067L8I4_JATCU; Uncharacterized protein
STRINGPOPTR_0001s01620.14e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1643089
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35550.48e-66basic pentacysteine 7