PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00016711-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family TALE
Protein Properties Length: 297aa    MW: 33562.9 Da    PI: 6.3219
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00016711-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.6e-082462792154
                         HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         k +yp+++++++L +++gL+ +q+ +WF N+R +
  WALNUT_00016711-RA 246 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 279
                         569*****************************87 PP

2ELK25.53.1e-09200221122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK +L++++++++ ++++E++
  WALNUT_00016711-RA 200 ELKIELKQGFKSRIEDVREEIL 221
                         9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.4E-183377IPR005540KNOX1
PfamPF037901.4E-163576IPR005540KNOX1
SMARTSM012565.9E-2488143IPR005541KNOX2
PfamPF037915.3E-1691142IPR005541KNOX2
PROSITE profilePS512139.132200220IPR005539ELK domain
PROSITE profilePS5007111.726220283IPR001356Homeobox domain
SMARTSM003892.0E-11222287IPR001356Homeobox domain
SuperFamilySSF466893.29E-16222286IPR009057Homeodomain-like
CDDcd000861.05E-11223284No hitNo description
Gene3DG3DSA:1.10.10.605.5E-25227284IPR009057Homeodomain-like
PfamPF059207.1E-18240279IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MDIEMQAPNL GMIGGGSTGG FSGEVAVSGE HQRQFKAEIA THPLCEQLLA AHVACLRVAT  60
PIDQLPLIDA QLDQSHHLLR SYASLRTHSL SPHERQELDN FLAQYLLVLC SFKEQLQQHV  120
RVHAVEAVVG CREIENTLQA LTGVSLDEGT GGTMSDDEDD LQIMDFALDQ SGADGHDMLG  180
FGPLLPTESE RSLMERVRQE LKIELKQGFK SRIEDVREEI LRKRRAGKLP GDTTSVLKNW  240
WQEHSKWPYP TEDDKAKLVE ETGLQLKQIN NWFINQRKRN WHSNSHSVTS LKSKRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276296RKRNWHSNSHSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in secondary cell wall biosynthesis. {ECO:0000269|PubMed:15980264}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018820513.10.0PREDICTED: homeobox protein HD1-like
RefseqXP_018820514.10.0PREDICTED: homeobox protein HD1-like
SwissprotQ9FPQ81e-168KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLA0A2I4EM950.0A0A2I4EM95_JUGRE; homeobox protein HD1-like
STRINGXP_007158449.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-166KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Srinivasasainagendra V,Page GP,Mehta T,Coulibaly I,Loraine AE
    CressExpress: a tool for large-scale mining of expression data from Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1004-16
    [PMID:18467456]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. He JB, et al.
    KNAT7 positively regulates xylan biosynthesis by directly activating IRX9 expression in Arabidopsis.
    J Integr Plant Biol, 2018. 60(6): p. 514-528
    [PMID:29393579]