PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00015876-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family HD-ZIP
Protein Properties Length: 324aa    MW: 36575.9 Da    PI: 4.8125
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00015876-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.7e-1960113356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  WALNUT_00015876-RA  60 KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 113
                         566899***********************************************9 PP

2HD-ZIP_I/II1283.9e-4159151193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++y++lk + ++L++++e L +e+
  WALNUT_00015876-RA  59 EKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYETLKLNYDALQHDNEVLLKEI 149
                         69*************************************************************************************9999 PP

         HD-ZIP_I/II  92 ke 93 
                         +e
  WALNUT_00015876-RA 150 RE 151
                         86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.65E-1944117IPR009057Homeodomain-like
PROSITE profilePS5007117.26555115IPR001356Homeobox domain
SMARTSM003891.1E-1758119IPR001356Homeobox domain
PfamPF000463.7E-1660113IPR001356Homeobox domain
CDDcd000862.82E-1760116No hitNo description
Gene3DG3DSA:1.10.10.606.6E-2062122IPR009057Homeodomain-like
PRINTSPR000319.3E-68695IPR000047Helix-turn-helix motif
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
PRINTSPR000319.3E-695111IPR000047Helix-turn-helix motif
PfamPF021837.2E-17115156IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MVVMKRLGSS DSLGALISIC PTTDEHSPRN NHVYSREFQS MLDGLDEEGC IEESGHIAEK  60
KRRLSVDQVK ALEKNFEVEN KLEPERKVKL AQELGLQPRQ VAVWFQNRRA RWKTKQLERD  120
YGVLKANYET LKLNYDALQH DNEVLLKEIR ELKTKLHDES AVSTLSVKEE IVVAESDIKP  180
IEQSKAAPDT PPLPTSDSKD LHFECFNHTN GLGASLFPVD FKDGSSDSDS SAILNEDNSP  240
NAATSSSGIL QNQQLLMSPA SSSLKFSCSN SPPPSLTCFQ FQKQFQPQFV KMEEHNFFSG  300
EEACNIFSDE QAPTLQWYCT EQWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107115RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that may act as growth regulators in response to water deficit. Interacts with the core sequence 5'-CAATTATTA-3' of promoters in response to ABA and in an ABI1-dependent manner. Involved in the negative regulation of the ABA signaling pathway. {ECO:0000269|PubMed:10527431, ECO:0000269|PubMed:12065416}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00271DAPTransfer from AT2G22430Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. Self expression regulation. {ECO:0000269|PubMed:10527431, ECO:0000269|PubMed:12065416, ECO:0000269|PubMed:16055682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018847757.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
SwissprotP466681e-81ATHB6_ARATH; Homeobox-leucine zipper protein ATHB-6
TrEMBLA0A2I4GV400.0A0A2I4GV40_JUGRE; homeobox-leucine zipper protein ATHB-6-like
STRINGEOX920161e-160(Theobroma cacao)
STRINGPOPTR_0005s07290.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.11e-82homeobox protein 6
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]