PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00015811-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family SBP
Protein Properties Length: 534aa    MW: 59297.7 Da    PI: 7.5632
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00015811-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.43.5e-42181256277
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         Cqv+gC++dls+ k+yh+rhkvC+vhsk+++v+v+g+eqrfCqqCsrfh l efDe+krsCr+rLa+hnerrrk+q
  WALNUT_00015811-RA 181 CQVHGCNKDLSSSKDYHKRHKVCDVHSKTTKVIVNGIEQRFCQQCSRFHLLAEFDEGKRSCRKRLAGHNERRRKPQ 256
                         **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.5E-33174242IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.718178255IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.29E-40179260IPR004333Transcription factor, SBP-box
PfamPF031101.0E-31181254IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MEPWSYTSEG KGLLFPDEID LQVDAFARSK KPLMEWDNKP NFSFESNGLV SDREAVDSMD  60
FVELGFPDFV RKPFHVNQGL EMLSGEVGSN SSQRAVSPSC IITSNSCFEE VASEEKLSSS  120
GMETNNQDLS LIDLKLGRLA DCKGAEGSKL FKHRPVLSSA PPSLLTKRAR KANSHSQAAF  180
CQVHGCNKDL SSSKDYHKRH KVCDVHSKTT KVIVNGIEQR FCQQCSRFHL LAEFDEGKRS  240
CRKRLAGHNE RRRKPQLDTL SGKHKLLQSY QDTRYLGTSF PRTRFVFPDI FRAGIVHPGK  300
SDQANWFTHI KLEGESFYSP QSAIPLANGQ LIPKSFLHLH DIGKQHGLGV PSAGTENCDV  360
TVSTIQELSG ASISSRALSL LSAQSQDLSS HLTGIPMASP QIMQGDSAHH VGVQIFEKPL  420
RASSMEQCGP SGFYSRGPMD VGKMGSIMFS DVSHAADFQV CTEGGFQDSD MLNAKYCPSP  480
EHGSTVDWLQ LSSHLQRVER QKNSIQVKQE NEDSCYFPTF RVVCNQQGTK TYPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-291802541084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018852397.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_018852398.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_018852399.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A2I4H8D20.0A0A2I4H8D2_JUGRE; squamosa promoter-binding-like protein 6
STRINGEOY016360.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-50SBP family protein