PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00015729-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 485aa    MW: 53672.7 Da    PI: 9.737
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00015729-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-31311366156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  WALNUT_00015729-RA 311 KQRRNWSPELHKRFLNALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 366
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-28308369IPR009057Homeodomain-like
PROSITE profilePS5129413.919308368IPR017930Myb domain
SuperFamilySSF466891.51E-17310369IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-27311366IPR006447Myb domain, plants
PfamPF002493.6E-8313364IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MALGKVEKPH ISISRIQEDS VGFSLRPWKP EIPNSCLRSQ IYIILWMCFR QNTFRCWGDY  60
IISSRPKRFA SETHNFTNGL SYFPSLSLFL NEKMQHHGGL SVQKYVKALE DELRKIQVFR  120
RELPLCLELV TQAIEACRQQ LSGTTTENNS HGQSESSEQT TSNDVPPVFE EFFPIKRSAS  180
SDDDNEEHHS HEANTETVIR NDSKKKSDWL RSVQLWNNPT SDPRPKEDVP RKATDLKRNG  240
GGGGGGAFQP FQREKSVGKS SASEGKTPSS VAREAAPAVG VATTSSSAVT ATGGSDGNDR  300
REQREGQSER KQRRNWSPEL HKRFLNALQQ LGGSHAATPK QIRELMKVDG LTNDEVKSHL  360
QKYRLHTRRP SPSIHNNGNP QQPQVVVVGG IWMPAPDYAA AMAASGEASG VAAANGIYAP  420
VAAPPPPPAV QQESSSQKVQ RLQHKECRPS KSQSEERFSH SGKRARSDSP ATSSSTHTTT  480
TFPVF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-135PREDICTED: probable transcription factor GLK2
TrEMBLD7T9871e-135D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.14e-79G2-like family protein