PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00014989-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 828aa    MW: 90808.5 Da    PI: 7.0179
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00014989-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49e-1584128147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r rWT+eE+ ++++a k++G   W +  +++g ++t+ q++s+ qk+
  WALNUT_00014989-RA  84 RERWTEEEHNRFLEALKLYGRA-WQRLEEHIG-TKTAVQIRSHAQKF 128
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-1678134IPR009057Homeodomain-like
PROSITE profilePS5129419.61379133IPR017930Myb domain
TIGRFAMsTIGR015571.0E-1582131IPR006447Myb domain, plants
SMARTSM007171.3E-1183131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-784124IPR009057Homeodomain-like
PfamPF002496.6E-1284127IPR001005SANT/Myb domain
CDDcd001671.79E-886129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 828 aa     Download sequence    Send to blast
MASVYLTLLF RLVPEKLQQR KRKQEIRFSV TSAYQLLSLT AAALVFLRGF EAASSFPGPL  60
MDTYSSGEEL IIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRLE EHIGTKTAVQ  120
IRSHAQKFFS KLEKEALIKG VPIGQALDIE IPPPRPKRKP TNPYPRKKSI SVPASLVGAK  180
DGKLLTSVSS LHFKQALDLE KEPPPENGSE KPKNAKDNQD DNCSVLFLHK EAQQSSVSSA  240
NKSSVSTPVV LRNSCMLREF IPSIKGAITQ DETNESFVTI EHKENQKSDK ADAKLVQGTS  300
TSKGSKLEKS NVPHEKSVQG EKTDDMSCAL PIEEMQTTQN YPRHVSVHIL DGSLGTCTQT  360
PSSDMSFQES IFHPIGEVRG HPNLFTNPAS TASSEHQNNI PRSSVQQSFP ALPPPFTPIF  420
HNQDDYQSFH LSSTFSSLIV SALLQNPAAH AAATFAATVW PYANVETSAD SPLGNPGGFP  480
LRQMGSTPSM AAIAANTVAA ATAWWAAHGL LPICAPLHTA YACVPPSTAS VSPMDDRPPA  540
AKIDREENTL QNPPMQQLEP EYSETVKAHN SASKSPTLSS ESVESGGAKL STGSKVDDHE  600
KVEAATELHD LNKAKNGKQV DRSSCGSNTT SGSEVETDAL EKHEKAKLEK HEKGMEEPTE  660
PDENSLAAEI SNRRSRIVTN VVDSWKEVSK EGRLAFQALF SRELLPQSFS PPHDEENKEH  720
QKDNIKEDKQ NNTDEENGNA SLLDLNSRTC GSCSNHHGNS KFEGSNNGED GLLKIGLGHG  780
NLKTCRTGFK PYKRCSVDAK ENRLTNTSIQ GEEKGPKRIR LVEGAAST
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11823QRKRKQ
2154167RPKRKPTNPYPRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018834196.10.0PREDICTED: protein LHY-like
RefseqXP_018834204.10.0PREDICTED: protein LHY-like
RefseqXP_018834213.10.0PREDICTED: protein LHY-like
TrEMBLA0A2I4FRF50.0A0A2I4FRF5_JUGRE; protein LHY-like
STRINGXP_006444706.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.14e-93circadian clock associated 1