PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00014904-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MIKC_MADS
Protein Properties Length: 267aa    MW: 30519.8 Da    PI: 8.6613
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00014904-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.81.2e-271868151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        kri+n++ rqvtfskRr g++KKA ELS+LCdae+a+i+fsstgkl++y+s
  WALNUT_00014904-RA 18 KRIDNTTARQVTFSKRRRGLFKKALELSTLCDAEIALIVFSSTGKLFDYAS 68
                        79***********************************************86 PP

2K-box41.84.6e-151542153596
               K-box  35 qRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                         + +++Ge+L+ L+++eLq+Leq L+ sl ++ ++Kne +l++i+ l+ k +++ +en++L++
  WALNUT_00014904-RA 154 NLKMKGEELQGLNVNELQELEQLLDASLGRVLETKNERFLKEISALKWKRDKMMDENQQLKQ 215
                         379*********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.0531070IPR002100Transcription factor, MADS-box
SMARTSM004323.1E-401069IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.2E-271173IPR002100Transcription factor, MADS-box
CDDcd002659.75E-351272No hitNo description
PROSITE patternPS0035001266IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-271232IPR002100Transcription factor, MADS-box
PfamPF003191.6E-241966IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-273247IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-274768IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.164124225IPR002487Transcription factor, K-box
PfamPF014861.9E-11156215IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGSDDFSGKM TRKKIQIKRI DNTTARQVTF SKRRRGLFKK ALELSTLCDA EIALIVFSST  60
GKLFDYASSR NNIFTITTTN HINVMHDLIV TFASRSKDRQ VIERHDLHSG RNLDKTNQPQ  120
SVELQLESTT YTLLSKEVVE KTHELRYYND IAINLKMKGE ELQGLNVNEL QELEQLLDAS  180
LGRVLETKNE RFLKEISALK WKRDKMMDEN QQLKQVENLL NVEAHLLGQG QPSELVTNIC  240
SSADPPHQDL HSSDTSLRLG LKAMKYA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-191069160MEF2C
5f28_B1e-191069160MEF2C
5f28_C1e-191069160MEF2C
5f28_D1e-191069160MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018826908.11e-145PREDICTED: MADS-box protein JOINTLESS-like isoform X2
SwissprotQ9FUY62e-69JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLA0A2I4F5I21e-143A0A2I4F5I2_JUGRE; MADS-box protein JOINTLESS-like isoform X2
STRINGXP_010254524.12e-74(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89033106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.13e-53MIKC_MADS family protein
Publications ? help Back to Top
  1. Nakano T,Kato H,Shima Y,Ito Y
    Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities.
    Plant Cell Physiol., 2015. 56(6): p. 1097-106
    [PMID:25746985]