PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00014774-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family BBR-BPC
Protein Properties Length: 291aa    MW: 32540.4 Da    PI: 10.1265
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00014774-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind346.75.3e-106122911301
           GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlal.sekkaavaerd.........maflqrdkalaernkalver 77 
                         mddd+ + rn+gyyep+  +k +lglqlms++a+rd+k     r+ n  +  + ++++++rd         m++  rd++ ++        
  WALNUT_00014774-RA  12 MDDDALNMRNWGYYEPS--FKGHLGLQLMSTMADRDTKHflpgRDPNSIMvNTANGTFHPRDcvvseapvpMNY-VRDSWANQ-------- 91 
                         9***9999*******99..************************888875515678899************99*9.999**999........ PP

           GAGA_bind  78 dnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkk 168
                         ++k+l++l+++         +++vl++t+ ++slq     q +d++++  e+      ++ e++ +++e  ++kkrq++  pk+++akk++
  WALNUT_00014774-RA  92 RDKFLNMLPANP--------NYGVLPETSGAHSLQI---LQPQDPSMD--ERM----VKV-EEPLVKSEGGQMKKRQSGGAPKTPRAKKPR 164
                         789******665........49***********999...445555555..322....222.234556677888889999********9999 PP

           GAGA_bind 169 kksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrK 259
                         k    ++++++++   +r+k  kk++d+v+ng+++D+s++P+PvCsCtG+++qCY+WG+GGWqSaCCtt++S+yPLP+stkrrgaRiagrK
  WALNUT_00014774-RA 165 K----PRDNNNPSV--QRVKPVKKNMDVVINGIDMDISGIPIPVCSCTGTPQQCYRWGCGGWQSACCTTNVSIYPLPMSTKRRGARIAGRK 249
                         9....434444444..69************************************************************************* PP

           GAGA_bind 260 mSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         mSqgafkk+LekLaa+Gy++snp+DL++hWA+HGtnkfvtir
  WALNUT_00014774-RA 250 MSQGAFKKVLEKLAADGYNFSNPIDLRTHWARHGTNKFVTIR 291
                         *****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062179.8E-11512291IPR010409GAGA-binding transcriptional activator
SMARTSM012261.6E-17512291IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MVAFFAPFVV LMDDDALNMR NWGYYEPSFK GHLGLQLMST MADRDTKHFL PGRDPNSIMV  60
NTANGTFHPR DCVVSEAPVP MNYVRDSWAN QRDKFLNMLP ANPNYGVLPE TSGAHSLQIL  120
QPQDPSMDER MVKVEEPLVK SEGGQMKKRQ SGGAPKTPRA KKPRKPRDNN NPSVQRVKPV  180
KKNMDVVING IDMDISGIPI PVCSCTGTPQ QCYRWGCGGW QSACCTTNVS IYPLPMSTKR  240
RGARIAGRKM SQGAFKKVLE KLAADGYNFS NPIDLRTHWA RHGTNKFVTI R
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Negatively regulates the homeotic gene AGL11/STK, which controls ovule primordium identity, by a cooperative binding to purine-rich elements present in the regulatory sequence leading to DNA conformational changes. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:15722463}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018840115.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like isoform X1
RefseqXP_018840124.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like isoform X1
SwissprotQ9SKD01e-111BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A2I4G8980.0A0A2I4G898_JUGRE; protein BASIC PENTACYSTEINE2-like isoform X1
STRINGXP_010105533.11e-176(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-112basic pentacysteine 2