PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00014729-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family SBP
Protein Properties Length: 536aa    MW: 59474.3 Da    PI: 8.4768
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00014729-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1344.8e-42178253277
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         Cqv gC++dls+ k+yh+rhkvC+vhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  WALNUT_00014729-RA 178 CQVYGCNKDLSSSKDYHKRHKVCDVHSKTTKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 253
                         **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.3E-33171239IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.351175252IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-39176257IPR004333Transcription factor, SBP-box
PfamPF031101.2E-31178251IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MMEPWSYNLE GKGLMFSDEI DLQVDVRATS KKPSEWGDKS TFNFERNGLV SNGEAVARME  60
LEFHDFVRKP FHGNQGMEIL SGEVCCSTSK RAVSPQCMFA SNSCFEEVAS EAKLSSSVLE  120
ANSLNSSLID LKLGRLADWK DVENSKILKY RPVLPSAPPS LLTKRARKTS SYSQTAFCQV  180
YGCNKDLSSS KDYHKRHKVC DVHSKTTKVI VNGIEQRFCQ QCSRFHLLAE FDDGKRSCRK  240
RLAGHNERRR KPQLDTLSGK HKLLQSYQGT GYLGTSLPKR TPFVFPDIFQ AGVVYPGKSV  300
QANGFRHIKL EGESFNSPQS AMPITSRQLL SNSILHLHSI GKQHCLGLPS SGTEDCNVTV  360
STVQELSGPS ISSRALSLLS AQSQDLSSHL TGIPMASPQI MQGDSAHHGN VQVSEKPLRV  420
SSMEQYGPNG LYSYGMNSIE VDKLGSIMFS DPSHAAGFQV HNDGIFQESK MLNAKYCLPD  480
HGSTVDWLQL SSHLQRVEQQ KNSPQVKQEN DGSCYFPTFR AVCNPQGMPN IFTLKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-29169251284squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018818464.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X2
TrEMBLA0A2I4EGD60.0A0A2I4EGD6_JUGRE; squamosa promoter-binding-like protein 6 isoform X2
STRINGEOY016360.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-50SBP family protein