PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00014580-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family BBR-BPC
Protein Properties Length: 233aa    MW: 25403.2 Da    PI: 10.7263
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00014580-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind233.61.5e-7165233134301
           GAGA_bind 134 alpieeaaeeakekkkkkkrqrakkpkekkak..kkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqC 222
                         ++p+++ ++++k++k +k++++ k p +  +k  k+k+ ++++ kk+k +s+++ +++++  i++ +++  +D s +P+P CsCtG+ r C
  WALNUT_00014580-RA  65 TEPMKNVNSTTKTAKGRKQKNSMKGPNQISSKafKPKQAKKTP-KKTKGQSMPDGKREKRMMINIDMDKAGFDSSEVPPPYCSCTGVARLC 154
                         3333444444444444444444444444433322555533333.444444445678999999***************************** PP

           GAGA_bind 223 YkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         YkWG+GGWqS+CCt++iS yPLP+s++r+gaR+agrKmS+ga+ klL +LaaeG dl +pvDLkdhWA+HGtnkfv i+
  WALNUT_00014580-RA 155 YKWGAGGWQSSCCTINISEYPLPMSSTRPGARMAGRKMSNGAYGKLLLRLAAEGRDLTHPVDLKDHWARHGTNKFVIIK 233
                         ****************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.2E-6022233IPR010409GAGA-binding transcriptional activator
PfamPF062174.0E-6667233IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MGTYSNRNTM IPEATAGASV PHFTWFYPGS FLSASKASSN PFQGTQTNPE PGLPVGPIRT  60
IAATTEPMKN VNSTTKTAKG RKQKNSMKGP NQISSKAFKP KQAKKTPKKT KGQSMPDGKR  120
EKRMMINIDM DKAGFDSSEV PPPYCSCTGV ARLCYKWGAG GWQSSCCTIN ISEYPLPMSS  180
TRPGARMAGR KMSNGAYGKL LLRLAAEGRD LTHPVDLKDH WARHGTNKFV IIK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018852201.11e-174PREDICTED: protein BASIC PENTACYSTEINE7-like
RefseqXP_018852202.11e-174PREDICTED: protein BASIC PENTACYSTEINE7-like
RefseqXP_018852203.11e-174PREDICTED: protein BASIC PENTACYSTEINE7-like
RefseqXP_018852204.11e-174PREDICTED: protein BASIC PENTACYSTEINE7-like
RefseqXP_018852205.11e-174PREDICTED: protein BASIC PENTACYSTEINE7-like
RefseqXP_018852206.11e-174PREDICTED: protein BASIC PENTACYSTEINE7-like
SwissprotO822861e-67BPC7_ARATH; Protein BASIC PENTACYSTEINE7
TrEMBLA0A2I4H7T81e-173A0A2I4H7T8_JUGRE; protein BASIC PENTACYSTEINE7-like
STRINGcassava4.1_015308m1e-118(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1643089
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35550.42e-65basic pentacysteine 7