PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00014255-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family YABBY
Protein Properties Length: 177aa    MW: 19751.4 Da    PI: 8.2919
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00014255-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY2031.2e-6261545170
               YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesasts 95 
                          +se+vCyv+CnfCnt lavsvP +sl+++vtvrCGhC++llsvn+a + q+++ ++              +  ++++  n e   s+s++
  WALNUT_00014255-RA   6 MASERVCYVHCNFCNTTLAVSVPCSSLLTMVTVRCGHCANLLSVNMAASLQAVPPQDT-------------Q--KQQYLINSEDCGSSSKY 81 
                         689******************************************9999999998885.............2..23333333444444444 PP

               YABBY  96 vsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                          +   ++   ++e +r pp irPPekrqrvPsaynrfi+eeiqrika+nPdishreafs+aaknWahfP+ih+gl
  WALNUT_00014255-RA  82 GKLAAFEAV-EHEQSRRPP-IRPPEKRQRVPSAYNRFIREEIQRIKAGNPDISHREAFSTAAKNWAHFPHIHYGL 154
                         444444333.444555566.9****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.9E-717154IPR006780YABBY protein
SuperFamilySSF470953.93E-895148IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.107.7E-5102148IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0010158Biological Processabaxial cell fate specification
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MSMDMMASER VCYVHCNFCN TTLAVSVPCS SLLTMVTVRC GHCANLLSVN MAASLQAVPP  60
QDTQKQQYLI NSEDCGSSSK YGKLAAFEAV EHEQSRRPPI RPPEKRQRVP SAYNRFIREE  120
IQRIKAGNPD ISHREAFSTA AKNWAHFPHI HYGLKVDDNK QAKLDQTLAG SEGTQNV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651638.11e-96PREDICTED: putative axial regulator YABBY 2 isoform X4
SwissprotQ9XFB02e-76YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLK9P2Z31e-109K9P2Z3_9R
STRINGVIT_06s0009g00880.t015e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.19e-78YABBY family protein