PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00013941-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family G2-like
Protein Properties Length: 374aa    MW: 42078.4 Da    PI: 9.8177
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00013941-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.22.9e-3176129255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH++Fv+ave+LGG+e+AtPk +l++m++kgL+++hvkSHLQ++R+
  WALNUT_00013941-RA  76 PRLRWTPDLHRCFVQAVERLGGQERATPKLVLQVMNIKGLSIAHVKSHLQMHRS 129
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.96272132IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2972130IPR009057Homeodomain-like
SuperFamilySSF466891.79E-1474130IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2276131IPR006447Myb domain, plants
PfamPF002491.7E-877128IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MKLGKKELIK MESGSCIGGL KVKSSSDRSD QEEAGSAGDD ESKTKNSASS SNSIVEETEK  60
SGSCIEVRPY VRSKVPRLRW TPDLHRCFVQ AVERLGGQER ATPKLVLQVM NIKGLSIAHV  120
KSHLQMHRSK KVDDQGQVII SRGHLTRSAD HFWQQSMLRS IDQRVSPKYR YGELYWTGQG  180
SCISRSPYFT DDMNLTRGVG LHGSIAERIS GGVDLNMIRN NNIAFEEESS KRLEEFQKEF  240
QWLFNHTSTK TQKSSTPCIE KKPNNIRESN PQWISAERKT GKRKGFHDDN HDLSLSLGIR  300
RPSRQAEASK RSTCWVDEEV DSSLSLSCSS SSKKRNYSID LNMPSKLISR LTEDYNVAKS  360
STATKLASTL DLTL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313237.21e-79hypothetical protein POPTR_0009s07890g, partial
RefseqXP_011003744.12e-79PREDICTED: probable transcription factor KAN4
TrEMBLB9HNC01e-79B9HNC0_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0009s07890.14e-79(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1655549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-43G2-like family protein