PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00013927-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family LBD
Protein Properties Length: 166aa    MW: 18414 Da    PI: 7.4216
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00013927-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.91.7e-4361051100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG++g i+ lq+++++l+
  WALNUT_00013927-RA   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPIHQRGDAVSSLVYEANARVRDPVYGCAGAISYLQNEVSKLE 96 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          +la++++e
  WALNUT_00013927-RA  97 MQLAVAQAE 105
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7665106IPR004883Lateral organ boundaries, LOB
PfamPF031958.1E-436103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MGGPSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPIHQRG  60
DAVSSLVYEA NARVRDPVYG CAGAISYLQN EVSKLEMQLA VAQAEILCIQ MQQQPNYLPT  120
NHIDVQAGEK SHLLSADFNN NMSQYLGFPS SSNVIQDPLK RESLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3786261e-107FQ378626.1 Vitis vinifera clone SS0AEB13YA05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278121.21e-94PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW32e-77LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA5CBH81e-94A5CBH8_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g07200.t013e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-78LBD family protein